Exopolyphosphatase Recombinant Protein | PPX1 recombinant protein
Recombinant Saccharomyces cerevisiae Exopolyphosphatase (PPX1)
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Exopolyphosphatase; N/A; Recombinant Saccharomyces cerevisiae Exopolyphosphatase (PPX1); Metaphosphatase; PPX1 recombinant protein
Host
E Coli
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer, 50% glycerol
Sequence Positions
1-397aa. Full length
Sequence
MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
Tag Info
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C, -80°C.
The shelf life of lyophilized form is 12 months at -20°C, -80°C.
Notes: Repeated freezing and thawing is not recommended.
Store working aliquots at 4°C for up to one week.
Generally, the shelf life of liquid form is 6 months at -20°C, -80°C.
The shelf life of lyophilized form is 12 months at -20°C, -80°C.
Notes: Repeated freezing and thawing is not recommended.
Store working aliquots at 4°C for up to one week.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49.1 kDa
NCBI Official Full Name
exopolyphosphatase
NCBI Official Symbol
PPX1
NCBI Protein Information
exopolyphosphatase
UniProt Protein Name
Exopolyphosphatase
UniProt Gene Name
PPX1
UniProt Synonym Gene Names
ExopolyPase
Similar Products
Product Notes
The PPX1 ppx1 (Catalog #AAA309809) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-397aa. Full length. The amino acid sequence is listed below: MSPLRKTVPE FLAHLKSLPI SKIASNDVLT ICVGNESADM DSIASAITYS YCQYIYNEGT YSEEKKKGSF IVPIIDIPRE DLSLRRDVMY VLEKLKIKEE ELFFIEDLKS LKQNVSQGTE LNSYLVDNND TPKNLKNYID NVVGIIDHHF DLQKHLDAEP RIVKVSGSCS SLVFNYWYEK LQGDREVVMN IAPLLMGAIL IDTSNMRRKV EESDKLAIER CQAVLSGAVN EVSAQGLEDS SEFYKEIKSR KNDIKGFSVS DILKKDYKQF NFQGKGHKGL EIGLSSIVKR MSWLFNEHGG EADFVNQCRR FQAERGLDVL VLLTSWRKAG DSHRELVILG DSNVVRELIE RVSDKLQLQL FGGNLDGGVA MFKQLNVEAT RKQVVPYLEE AYSNLEE. It is sometimes possible for the material contained within the vial of "Exopolyphosphatase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.