Prominin-1 (Prom1) Recombinant Protein | Prom1 recombinant protein
Recombinant Mouse Prominin-1 (Prom1)
Gene Names
Prom1; Prom; AC133; CD133; Prom-1; Proml1; 4932416E19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prominin-1 (Prom1); N/A; Recombinant Mouse Prominin-1 (Prom1); Recombinant Prominin-1 (Prom1); Prominin-1; Antigen AC133 homolog Prominin-like protein 1 CD_antigen= CD133; Prom1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
509-794aa; Extracellular Domain
Sequence
GANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQLPEGKPKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLN
Sequence Length
794
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for Prom1 recombinant protein
May play a role in cell differentiation, proliferation and apoptosis. Binds cholesterol in cholesterol-containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48.5 kDa
NCBI Official Full Name
prominin-1 isoform s3
NCBI Official Synonym Full Names
prominin 1
NCBI Official Symbol
Prom1
NCBI Official Synonym Symbols
Prom; AC133; CD133; Prom-1; Proml1; 4932416E19Rik
NCBI Protein Information
prominin-1; prominin-like 1; antigen AC133 homolog; prominin-like protein 1
UniProt Protein Name
Prominin-1
UniProt Gene Name
Prom1
UniProt Synonym Gene Names
Prom; Proml1
UniProt Entry Name
PROM1_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Prom1 prom1 (Catalog #AAA115291) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 509-794aa; Extracellular Domain. The amino acid sequence is listed below: GANVEKLLCE PYENKKLLQV LDTPYLLKEQ WQFYLSGMLF NNPDINMTFE QVYRDCKRGR GIYAAFQLEN VVNVSDHFNI DQISENINTE LENLNVNIDS IELLDNTGRK SLEDFAHSGI DTIDYSTYLK ETEKSPTEVN LLTFASTLEA KANQLPEGKP KQAFLLDVQN IRAIHQHLLP PVQQSLNTLR QSVWTLQQTS NKLPEKVKKI LASLDSVQHF LTNNVSLIVI GETKKFGKTI LGYFEHYLHW VFYAITEKMT SCKPMATAMD SAVNGILCGY VADPLN. It is sometimes possible for the material contained within the vial of "Prominin-1 (Prom1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
