Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Trypsin-2 (PRSS2) Recombinant Protein | PRSS2 recombinant protein

Recombinant Human Trypsin-2 (PRSS2)

Average rating 0.0
No ratings yet
Gene Names
PRSS2; TRY2; TRY8; TRYP2
Purity
>=90%
Synonyms
Trypsin-2 (PRSS2); N/A; Recombinant Human Trypsin-2 (PRSS2); Recombinant Trypsin-2 (PRSS2); Trypsin-2 EC= 3.4.21.4; Anionic trypsinogen Serine protease 2 Trypsin II; PRSS2 recombinant protein
Ordering
Purity/Purification
>=90%
Form/Format
Liquid containing glycerol
Sequence Positions
24-247
Sequence
IVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
Sequence Length
247
Species
Homo sapiens (Human)
Product Note
Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for PRSS2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,488 Da
NCBI Official Full Name
trypsin-2 preproprotein
NCBI Official Synonym Full Names
protease, serine, 2 (trypsin 2)
NCBI Official Symbol
PRSS2
NCBI Official Synonym Symbols
TRY2; TRY8; TRYP2
NCBI Protein Information
trypsin-2; trypsin 2; trypsin II; trypsinogen 2; serine protease 2; anionic trypsinogen; protease serine 2 preproprotein; protease, serine, 2, preproprotein
UniProt Protein Name
Trypsin-2
UniProt Gene Name
PRSS2
UniProt Synonym Gene Names
TRY2; TRYP2
UniProt Entry Name
TRY2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PRSS2 prss2 (Catalog #AAA113680) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-247. The amino acid sequence is listed below: IVGGYICEEN SVPYQVSLNS GYHFCGGSLI SEQWVVSAGH CYKSRIQVRL GEHNIEVLEG NEQFINAAKI IRHPKYNSRT LDNDILLIKL SSPAVINSRV SAISLPTAPP AAGTESLISG WGNTLSSGAD YPDELQCLDA PVLSQAECEA SYPGKITNNM FCVGFLEGGK DSCQGDSGGP VVSNGELQGI VSWGYGCAQK NRPGVYTKVY NYVDWIKDTI AANS. It is sometimes possible for the material contained within the vial of "Trypsin-2 (PRSS2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.