Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Prostaglandin E2 receptor EP3 subtype (PTGER3) Recombinant Protein | PTGER3 recombinant protein

Recombinant Human Prostaglandin E2 receptor EP3 subtype (PTGER3)

Gene Names
PTGER3; EP3; EP3e; EP3-I; EP3-II; EP3-IV; PGE2-R; EP3-III
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prostaglandin E2 receptor EP3 subtype (PTGER3); N/A; Recombinant Human Prostaglandin E2 receptor EP3 subtype (PTGER3); Recombinant Prostaglandin E2 receptor EP3 subtype (PTGER3); Prostaglandin E2 receptor EP3 subtype; PGE receptor EP3 subtype; PGE2 receptor EP3 subtype; PGE2-R Prostanoid EP3 receptor; PTGER3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1–53aa; Partial
Sequence
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,310 Da
NCBI Official Full Name
prostaglandin E2 receptor EP3 subtype isoform 4
NCBI Official Synonym Full Names
prostaglandin E receptor 3 (subtype EP3)
NCBI Official Symbol
PTGER3
NCBI Official Synonym Symbols
EP3; EP3e; EP3-I; EP3-II; EP3-IV; PGE2-R; EP3-III
NCBI Protein Information
prostaglandin E2 receptor EP3 subtype; prostanoid EP3 receptor; PGE receptor, EP3 subtype; PGE2 receptor EP3 subtype; prostaglandin receptor (PGE-2); prostaglandin E receotor EP3 subtype 3 isoform
UniProt Protein Name
Prostaglandin E2 receptor EP3 subtype
UniProt Gene Name
PTGER3
UniProt Synonym Gene Names
PGE receptor EP3 subtype
UniProt Entry Name
PE2R3_HUMAN

Similar Products

Product Notes

The PTGER3 ptger3 (Catalog #AAA113453) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1–53aa; Partial. The amino acid sequence is listed below: MKETRGYGGD APFCTRLNHS YTGMWAPERS AEARGNLTRP PGSGEDCGSV SVA. It is sometimes possible for the material contained within the vial of "Prostaglandin E2 receptor EP3 subtype (PTGER3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.