Prostacyclin Recombinant Protein | PGI recombinant protein

Recombinant Human Prostacyclin (PGI)

Cat. Num. AAA55769

• Gene Names: PTGIR; IP; PRIPR
• Applications: ELISA, Western Blot
• Purity: >90 % as determined by SDS-PAGE
• Synonyms: Prostacyclin; N/A; Recombinant Human Prostacyclin (PGI); Prostaglandin I2; PGI2.; PGI recombinant protein

• Host: E.coli AA 100-285.
• Purity/Purification: >90 % as determined by SDS-PAGE
• Form/Format: Lyophilized Powder; The purified protein was Lyophilized from sterile PBS (58 mM Na2HPO4,17 mM NaH2PO4, 68 mM NaCl, pH 7.4). 5% trehalose and 5% mannitol are added as protectant before lyophilization. The elution buffer contain 300 mM imidazole.
• Sequence: AIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFS YSFLLRAGYLTLYGIEALPRTHESQAQDRVHSADVFHTFRQLDRLLPKLARGSLSVGDKDHMCSVKSRL WKLLSPARLARRAHRSKWLESYLLHLEEMGVSEEMQARALVLQLWATQ
• Sequence Length: 386

• Applicable Applications for PGI recombinant protein: ELISA, WB (Western Blot)
• Source: Human
• Protein Residue: N-terminal 6*His-tagged.
• Usage: PGI Protein - Reconstitute at 0.25 ug/uL in 200 uL sterile water for short-term storage. Reconstitution with 200 uL 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).; Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Preparation and Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. **Avoid repeated freeze-thaw cycles.**; Stability: The recombinant protein is stable for up to 6-12 months from date of receipt at -80°C.

SDS-PAGE

Related Product Information for PGI recombinant protein

Prostacyclin is produced in endothelial cells from prostaglandin H2 (PGH2) by the action of the enzyme prostacyclin synthase. Although prostacyclin is considered an independent mediator, it is called PGI2 in eicosanoid nomenclature, and is a member of the prostanoids.The series-3 prostaglandin PGH3 also follows the prostacyclin synthase pathway, yielding another prostacyclin, PGI3. The unqualified term 'prostacyclin' usually refers to PGI2. PGI2 is derived from the omega-6 arachidonic acid. PGI3 is derived from the omega-3 EPA. Prostacyclin (PGI2) chiefly prevents formation of the platelet plug involved in primary hemostasis (a part of blood clot formation). It does this by inhibiting platelet activation. It is also an effective vasodilator. Prostacyclin's interactions in contrast to thromboxane (TXA2), another eicosanoid, strongly suggest a mechanism of cardiovascular homeostasis between the two hormones in relation to vascular damage.

NCBI and Uniprot Product Information

• NCBI GI #: 4506263
• NCBI GeneID: 5739
• NCBI Accession #: NP_000951.1
• NCBI GenBank Nucleotide #: NM_000960.3
• Molecular Weight: Predicted MW: 24 kDa; Observed MW: 24 kDa
• NCBI Official Full Name: prostacyclin receptor
• NCBI Official Synonym Full Names: prostaglandin I2 (prostacyclin) receptor (IP)
• NCBI Official Symbol: PTGIR
• NCBI Official Synonym Symbols: IP; PRIPR
• NCBI Protein Information: prostacyclin receptor; PGI receptor; PGI2 receptor; prostanoid IP receptor; prostaglandin I2 receptor
• UniProt Protein Name: Prostacyclin receptor
• UniProt Gene Name: PTGIR
• UniProt Synonym Gene Names: PRIPR; PGI receptor; PGI2 receptor
• UniProt Entry Name: PI2R_HUMAN