Prostacyclin Recombinant Protein | PGI recombinant protein
Recombinant Human Prostacyclin (PGI)
Gene Names
PTGIR; IP; PRIPR
Applications
ELISA, Western Blot
Purity
>90 % as determined by SDS-PAGE
Synonyms
Prostacyclin; N/A; Recombinant Human Prostacyclin (PGI); Prostaglandin I2; PGI2.; PGI recombinant protein
Host
E.coli AA 100-285.
Purity/Purification
>90 % as determined by SDS-PAGE
Form/Format
Lyophilized Powder; The purified protein was Lyophilized from sterile PBS (58 mM Na2HPO4,17 mM NaH2PO4, 68 mM NaCl, pH 7.4). 5% trehalose and 5% mannitol are added as protectant before lyophilization. The elution buffer contain 300 mM imidazole.
Sequence
AIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFS YSFLLRAGYLTLYGIEALPRTHESQAQDRVHSADVFHTFRQLDRLLPKLARGSLSVGDKDHMCSVKSRL WKLLSPARLARRAHRSKWLESYLLHLEEMGVSEEMQARALVLQLWATQ
Sequence Length
386
Applicable Applications for PGI recombinant protein
ELISA, WB (Western Blot)
Source
Human
Protein Residue
N-terminal 6*His-tagged.
Usage
PGI Protein - Reconstitute at 0.25 ug/uL in 200 uL sterile water for short-term storage. Reconstitution with 200 uL 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. **Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 6-12 months from date of receipt at -80°C.
Stability: The recombinant protein is stable for up to 6-12 months from date of receipt at -80°C.
Related Product Information for PGI recombinant protein
Prostacyclin is produced in endothelial cells from prostaglandin H2 (PGH2) by the action of the enzyme prostacyclin synthase. Although prostacyclin is considered an independent mediator, it is called PGI2 in eicosanoid nomenclature, and is a member of the prostanoids.The series-3 prostaglandin PGH3 also follows the prostacyclin synthase pathway, yielding another prostacyclin, PGI3. The unqualified term 'prostacyclin' usually refers to PGI2. PGI2 is derived from the omega-6 arachidonic acid. PGI3 is derived from the omega-3 EPA. Prostacyclin (PGI2) chiefly prevents formation of the platelet plug involved in primary hemostasis (a part of blood clot formation). It does this by inhibiting platelet activation. It is also an effective vasodilator. Prostacyclin's interactions in contrast to thromboxane (TXA2), another eicosanoid, strongly suggest a mechanism of cardiovascular homeostasis between the two hormones in relation to vascular damage.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted MW: 24 kDa
Observed MW: 24 kDa
Observed MW: 24 kDa
NCBI Official Full Name
prostacyclin receptor
NCBI Official Synonym Full Names
prostaglandin I2 (prostacyclin) receptor (IP)
NCBI Official Symbol
PTGIR
NCBI Official Synonym Symbols
IP; PRIPR
NCBI Protein Information
prostacyclin receptor; PGI receptor; PGI2 receptor; prostanoid IP receptor; prostaglandin I2 receptor
UniProt Protein Name
Prostacyclin receptor
UniProt Gene Name
PTGIR
UniProt Synonym Gene Names
PRIPR; PGI receptor; PGI2 receptor
UniProt Entry Name
PI2R_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The PGI ptgir (Catalog #AAA55769) is a Recombinant Protein produced from E.coli AA 100-285. and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Prostacyclin can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the PGI ptgir for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AIFLMERIFD VQLPHYSPSD EKARMKLTLL HRELQALTEA MYTNLHAVLL GDATEAGSGW HEMGLLDFS YSFLLRAGYL TLYGIEALPR THESQAQDRV HSADVFHTFR QLDRLLPKLA RGSLSVGDKD HMCSVKSRL WKLLSPARLA RRAHRSKWLE SYLLHLEEMG VSEEMQARAL VLQLWATQ. It is sometimes possible for the material contained within the vial of "Prostacyclin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
