Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113216_SDS_PAGE15.jpg SDS-PAGE

Parathyroid hormone 2 receptor Recombinant Protein | PTH2R recombinant protein

Recombinant Human Parathyroid hormone 2 receptor

Average rating 0.0
No ratings yet
Gene Names
PTH2R; PTHR2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Parathyroid hormone 2 receptor; N/A; Recombinant Human Parathyroid hormone 2 receptor; PTH2R recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-145aa; Extracellular Domain
Sequence
DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY
Sequence Length
550
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA113216_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for PTH2R recombinant protein
This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor.
Product Categories/Family for PTH2R recombinant protein
References
Identification and functional expression of a receptor selectively recognizing parathyroid hormone, the PTH2 receptor.Usdin T.B., Gruber C., Bonner T.I.J. Biol. Chem. 270:15455-15458(1995) cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org) .King M.M., Aronstam R.S., Sharma S.V. Assignment of the human PTH2 receptor gene (PTHR2) to chromosome 2q33 by fluorescence in situ hybridization.Usdin T.B., Modi W., Bonner T.I.Genomics 37:140-141(1996) Identification and characterization of the murine and human gene encoding the tuberoinfundibular peptide of 39 residues.John M.R., Arai M., Rubin D.A., Jonsson K.B., Jueppner H.Endocrinology 143:1047-1057(2002)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.6 kDa
NCBI Official Full Name
parathyroid hormone 2 receptor isoform 2
NCBI Official Synonym Full Names
parathyroid hormone 2 receptor
NCBI Official Symbol
PTH2R
NCBI Official Synonym Symbols
PTHR2
NCBI Protein Information
parathyroid hormone 2 receptor
UniProt Protein Name
Parathyroid hormone 2 receptor
UniProt Gene Name
PTH2R
UniProt Synonym Gene Names
PTHR2; PTH2 receptor
UniProt Entry Name
PTH2R_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PTH2R pth2r (Catalog #AAA113216) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-145aa; Extracellular Domain. The amino acid sequence is listed below: DSDGTITIEE QIVLVLKAKV QCELNITAQL QEGEGNCFPE WDGLICWPRG TVGKISAVPC PPYIYDFNHK GVAFRHCNPN GTWDFMHSLN KTWANYSDCL RFLQPDISIG KQEFFERLY. It is sometimes possible for the material contained within the vial of "Parathyroid hormone 2 receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.