Receptor-type tyrosine-protein phosphatase-like N (Ptprn) Recombinant Protein | Ptprn\r recombinant protein
Recombinant Mouse Receptor-type tyrosine-protein phosphatase-like N (Ptprn), partial
Gene Names
Ptprn; IA-2; mIA-A; mKIAA4064
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Receptor-type tyrosine-protein phosphatase-like N (Ptprn); N/A; Recombinant Mouse Receptor-type tyrosine-protein phosphatase-like N (Ptprn), partial; Ptprn\r recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
169-439aa; partial
Sequence
SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ptprn\r recombinant protein
This protein is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
106,083 Da
NCBI Official Full Name
Receptor-type tyrosine-protein phosphatase-like N
NCBI Official Synonym Full Names
protein tyrosine phosphatase, receptor type, N
NCBI Official Symbol
Ptprn
NCBI Official Synonym Symbols
IA-2; mIA-A; mKIAA4064
NCBI Protein Information
receptor-type tyrosine-protein phosphatase-like N
UniProt Protein Name
Receptor-type tyrosine-protein phosphatase-like N
UniProt Gene Name
Ptprn
UniProt Synonym Gene Names
Ptp35; R-PTP-N; ICA512-NTF; ICA512-TMF; ICA512-CCF
Similar Products
Product Notes
The Ptprnr ptprn (Catalog #AAA116622) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 169-439aa; partial. The amino acid sequence is listed below: SVCSTSSLYL QDLSAAASEC IDPSVVFPYP LNDSSSPKSC ASQDSSAFSP SSDSLLSSTE SSPQGSPEPL VLHEETPPTT SSDSEEEQED EEEIDVVSVE KRQAPGKRSE SGSPSAGGHS KPPHSPLVLK RCHVSTHQHN YAAPPSTRKD YPAAKRVKLD SVRVLRQISN NRKCTSPRSS DTEENVKRRT HNVLERQRRN ELKRSFFALR DQIPELENNE KAPKVVILKK ATAYILSVQA EEQKLISEED LLRKRREQLK HKLEQLRNSC A. It is sometimes possible for the material contained within the vial of "Receptor-type tyrosine-protein phosphatase-like N (Ptprn), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.