Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA62151_AD13.jpg Application Data

HIV-1 gp120 cDNA Clone | pUC-gp120 cdna clone

HIV-1 gp120 (ADA)(Clade B) cDNA Clone

Average rating 0.0
No ratings yet
Synonyms
HIV-1 gp120; N/A; HIV-1 gp120 (ADA)(Clade B) cDNA Clone; pUC-gp120 (ADA)(HIV-1/Clade B); cDNA clone of HIV-1 gp120(aa34-518) (ADA)(Clade B); pUC-gp120 cdna clone
Ordering
Sequence
WVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLENVTENFNMWKNNMVEQMHEDIISLWDQ SLKPCVKLTPLCVTLNCTDLRNVTNINNSSEGMRGEIKNCSFNITTSIRDKVKKDYALFYRLDVVPIDNDNTSYRLINCN TSTITQACPKVSFEPIPIHYCTPAGFAILKCKDKKFNGTGPCKNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSSNF TDNAKNIIVQLKESVEINCTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHCNISRTKWNNTLNQIATKLKEQFGNNKT IVFNQSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWNFNGTWNLTQSNGTEGNDTITLPCRIKQIINMWQEVGKAMYAP PIRGQIRCSSNITGLILTRDGGTNSSGSEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKRAVGTIG AMFLG
Restriction Enzyme Digestion
Lane 1, digested with BamHI and XbaI Lane 2, DNA ladder
Cloning Site
EcoRV
Vector
pUC57
cDNA Insert Size
1455 bp codon optimized HIV-1 gp120 (ADA)(Clade B) cDNA, corresponding to amino acid 34-518 (Gene accession# M60472) inserted at EcoRV site of pUC57 vector
Preparation and Storage
4 degree C

Application Data

product-image-AAA62151_AD13.jpg Application Data

Application Data

product-image-AAA62151_AD15.jpg Application Data
Related Product Information for pUC-gp120 cdna clone
Description: 1455 bp full-length cDNA clone of HIV-1 gp120(aa34-518) (ADA)(Clade B) (M60472)

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The pUC-gp120 (Catalog #AAA62151) is a cDNA Clone and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: WVTVYYGVPV WKEATTTLFC ASDAKAYDTE VHNVWATHAC VPTDPNPQEV VLENVTENFN MWKNNMVEQM HEDIISLWDQ SLKPCVKLT PLCVTLNCTD LRNVTNINNS SEGMRGEIKN CSFNITTSIR DKVKKDYALF YRLDVVPIDN DNTSYRLINC N TSTITQAC PKVSFEPIPI HYCTPAGFAI LKCKDKKFNG TGPCKNVSTV QCTHGIRPVV STQLLLNGSL AEEEVVIRSS NF TDNAKNI IVQLKESVEI NCTRPNNNTR KSIHIGPGRA FYTTGEIIGD IRQAHCNISR TKWNNTLNQI ATKLKEQFGN NKT IVFNQS SGGDPEIVMH SFNCGGEFFY CNSTQLFNST WNFNGTWNLT QSNGTEGNDT ITLPCRIKQI INMWQEVGKA MYAP PIRGQ IRCSSNITGL ILTRDGGTNS SGSEIFRPGG GDMRDNWRSE LYKYKVVKIE PLGVAPTKAK RRVVQREKRA VGTIG AMFL G. It is sometimes possible for the material contained within the vial of "HIV-1 gp120, cDNA Clone" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.