Rabbit Dapl1 Antibody | anti-DAPL1 antibody
Dapl1 Antibody - N-terminal region
Gene Names
Dapl1; EEDA; 2310032F03Rik
Reactivity
Tested Reactivity: MousePredicted Reactivity: Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Dapl1; N/A; Dapl1 Antibody - N-terminal region; anti-DAPL1 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Mouse
Predicted Reactivity: Cow, Dog, Human, Mouse, Pig, Rat
Predicted Reactivity: Cow, Dog, Human, Mouse, Pig, Rat
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
MANEVQVLPSPLKGRYAPAVKAGGMRISKKQEMGVLERHTKKTGLEKTSA
Applicable Applications for anti-DAPL1 antibody
WB (Western Blot)
Protein Size (# AA)
107 amino acids
Blocking Peptide
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dapl1
Replacement Item
This antibody may replace item sc-139335 from Santa Cruz Biotechnology.
Predicted Homology
Cow: 86%; Dog: 79%; Human: 100%; Mouse: 86%; Pig: 79%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-DAPL1 antibody
This is a rabbit polyclonal antibody against Dapl1. It was validated on Western Blot
Target Description: Dapl1 may play a role in the early stages of epithelial differentiation or in apoptosis.
Target Description: Dapl1 may play a role in the early stages of epithelial differentiation or in apoptosis.
Product Categories/Family for anti-DAPL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
death-associated protein-like 1
NCBI Official Synonym Full Names
death associated protein-like 1
NCBI Official Symbol
Dapl1
NCBI Official Synonym Symbols
EEDA; 2310032F03Rik
NCBI Protein Information
death-associated protein-like 1
UniProt Protein Name
Death-associated protein-like 1
UniProt Gene Name
Dapl1
UniProt Synonym Gene Names
Eeda
UniProt Entry Name
DAPL1_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The DAPL1 dapl1 (Catalog #AAA201397) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Dapl1 Antibody - N-terminal region reacts with Tested Reactivity: Mouse Predicted Reactivity: Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Dapl1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DAPL1 dapl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MANEVQVLPS PLKGRYAPAV KAGGMRISKK QEMGVLERHT KKTGLEKTSA. It is sometimes possible for the material contained within the vial of "Dapl1, Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
