Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Retinoblastoma Recombinant Protein | RB1 recombinant protein

Recombinant Human Retinoblastoma Associated Protein

Average rating 0.0
No ratings yet
Gene Names
RB1; RB; pRb; OSRC; pp110; p105-Rb; PPP1R130
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Retinoblastoma; N/A; Recombinant Human Retinoblastoma Associated Protein; RB, OSRC, RB-1, RB1, p105-Rb, OSTEOSARCOMA, RETINOBLASTOMA-RELATED,PP110, Retinoblastoma-associated protein.; RB1 recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
The RB1 was lyophilized in 1xPBS pH-7.4.
Sequence
MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH
Sequence Length
928
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized Retinoblastoma in sterile 18Momega-cm H20 not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18 degrees C. Upon reconstitution Retinoblastoma should be stored at 4 degrees C between 2-7 days and for future use below -18 degrees C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Related Product Information for RB1 recombinant protein
Retinoblastoma Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16.5 kDa. The Retinoblastoma is purified by proprietary chromatographic techniques.
Product Categories/Family for RB1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
retinoblastoma-associated protein
NCBI Official Synonym Full Names
retinoblastoma 1
NCBI Official Symbol
RB1
NCBI Official Synonym Symbols
RB; pRb; OSRC; pp110; p105-Rb; PPP1R130
NCBI Protein Information
retinoblastoma-associated protein; prepro-retinoblastoma-associated protein; protein phosphatase 1, regulatory subunit 130; retinoblastoma suspectibility protein
UniProt Protein Name
Retinoblastoma-associated protein
UniProt Gene Name
RB1
UniProt Synonym Gene Names
Rb
UniProt Entry Name
RB_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RB1 rb1 (Catalog #AAA10852) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MASFPSSPLR IPGGNIYISP LKSPYKISEG LPTPTKMTPR SRILVSIGES FGTSEKFQKI NQMVCNSDRV LKRSAEGSNP PKPLKKLRFD IEGSDEADGS KHLPGESKFQ QKLAEMTSTR TRMQKQKMND SMDTSNKEEK HHHHHH. It is sometimes possible for the material contained within the vial of "Retinoblastoma, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.