Recoverin Recombinant Protein | RCVRN recombinant protein

Recombinant Human Recoverin

Cat. Num. AAA18509

• Gene Names: RCVRN; RCV1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Recoverin; N/A; Recombinant Human Recoverin; Cancer-associated retinopathy protein; Protein CAR; RCVRN recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-200aa;Full Length of Mature Protein
• Sequence: GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for RCVRN recombinant protein

Ses to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.

Product Categories/Family for RCVRN recombinant protein

Neuroscience

References

Isolation of human retinal genes recoverin cDNA and gene.Murakami A., Yajima T., Inana G.Biochem. Biophys. Res. Commun. 187:234-244(1992) Molecular cloning and nucleotide sequence of a cDNA encoding recoverin from human retina.Wiechmann A.F., Hammarback J.A.Exp. Eye Res. 56:463-470(1993) The cancer-associated retinopathy antigen is a recoverin-like protein.Thirkill C.E., Tait R.C., Tyler N.K., Roth A.M., Keltner J.L.Invest. Ophthalmol. Vis. Sci. 33:2768-2772(1992) Expression of a photoreceptor protein, recoverin, as a cancer-associated retinopathy autoantigen in human lung cancer cell lines.Matsubara S., Yamaji Y., Sato M., Fujita J., Takahara J.Br. J. Cancer 74:1419-1422(1996) Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.Oshikawa M., Tsutsui C., Ikegami T., Fuchida Y., Matsubara M., Toyama S., Usami R., Ohtoko K., Kato S.Invest. Ophthalmol. Vis. Sci. 52:6662-6670(2011) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. A photoreceptor calcium binding protein is recognized by autoantibodies obtained from patients with cancer-associated retinopathy.Polans A.S., Buczylko J., Crabb J., Palczewski K.J. Cell Biol. 112:981-989(1991) Crystal structure of human recoverin at 2.2 A resolution.RIKEN structural genomics initiative (RSGI) Submitted (FEB-2007) to the PDB data bank

NCBI and Uniprot Product Information

• NCBI GI #: 4506459
• NCBI GeneID: 5957
• NCBI Accession #: NP_002894.1
• NCBI GenBank Nucleotide #: NM_002903.2
• UniProt Accession #: P35243; Q53XL0
• Molecular Weight: 25 kDa
• NCBI Official Full Name: recoverin
• NCBI Official Synonym Full Names: recoverin
• NCBI Official Symbol: RCVRN
• NCBI Official Synonym Symbols: RCV1
• NCBI Protein Information: recoverin
• UniProt Protein Name: Recoverin
• UniProt Gene Name: RCVRN
• UniProt Synonym Gene Names: RCV1; Protein CAR
• UniProt Entry Name: RECO_HUMAN