Regenerating islet-derived protein 3-beta Recombinant Protein | Reg3b recombinant protein
Recombinant Rat Regenerating islet-derived protein 3-beta
Gene Names
Reg3b; Pap; Pap1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Regenerating islet-derived protein 3-beta; N/A; Recombinant Rat Regenerating islet-derived protein 3-beta; Pancreatitis-associated protein 1; Peptide 23; REG-2; Regenerating islet-derived protein III-beta; Reg III-beta; Reg3b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-175aa; Full Length
Sequence
EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG
Sequence Length
180
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Reg3b recombinant protein
Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S. typhimurium. May play a role in protection against infection with S. enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues.
References
Messenger RNA sequence and expression of rat pancreatitis-associated protein, a lectin-related protein overexpressed during acute experimental pancreatitis.Iovanna J., Orelle B., Keim V., Dagorn J.-C.J. Biol. Chem. 266:24664-24669(1991) PAP, a pancreatic secretory protein induced during acute pancreatitis, is expressed in rat intestine.Iovanna J.L., Keim V., Bosshard A., Orelle B., Frigerio J.-M., Dusetti N., Dagorn J.-C.Am. J. Physiol. 265:G611-G618(1993) Structural organization of the gene encoding the rat pancreatitis-associated protein. Analysis of its evolutionary history reveals an ancient divergence from the other carbohydrate-recognition domain-containing genes.Dusetti N.J., Frigerio J.-M., Keim V., Dagorn J.-C., Iovanna J.J. Biol. Chem. 268:14470-14475(1993) Sequence of a cDNA clone encoding a rat Reg-2 protein.Kamimura T., West C., Beutler E.Gene 118:299-300(1992) Molecular cloning and expression of peptide 23, a growth hormone-releasing hormone-inducible pituitary protein.Katsumata N., Chakraborty C., Myal Y., Schroedter I.C., Murphy L.J., Shiu R.P., Friesen H.G.Endocrinology 136:1332-1339(1995)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20.6 kDa
NCBI Official Full Name
regenerating islet-derived protein 3-beta
NCBI Official Synonym Full Names
regenerating islet-derived 3 beta
NCBI Official Symbol
Reg3b
NCBI Official Synonym Symbols
Pap; Pap1
NCBI Protein Information
regenerating islet-derived protein 3-beta
UniProt Protein Name
Regenerating islet-derived protein 3-beta
UniProt Gene Name
Reg3b
UniProt Synonym Gene Names
Pap; Pap1; Reg2; REG-3-beta; Reg III-beta
UniProt Entry Name
REG3B_RAT
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Reg3b reg3b (Catalog #AAA114463) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-175aa; Full Length. The amino acid sequence is listed below: EDSPKKIPSA RISCPKGSQA YGSYCYALFQ IPQTWFDAEL ACQKRPEGHL VSVLNVAEAS FLASMVKNTG NSYQYTWIGL HDPTLGGEPN GGGWEWSNND IMNYVNWERN PSTALDRGFC GSLSRSSGFL RWRDTTCEVK LPYVCKFTG. It is sometimes possible for the material contained within the vial of "Regenerating islet-derived protein 3-beta, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
