Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA115770_SDS_PAGE15.jpg SDS-PAGE

Regenerating islet-derived protein 3-gamma Recombinant Protein | Reg3g recombinant protein

Recombinant Mouse Regenerating islet-derived protein 3-gamma

Gene Names
Reg3g; AI449515
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Regenerating islet-derived protein 3-gamma; N/A; Recombinant Mouse Regenerating islet-derived protein 3-gamma; Pancreatitis-associated protein 3; Regenerating islet-derived protein III-gamma; Reg III-gamma; Reg3g recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-174. Partial-length
Sequence
EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA115770_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Reg3g recombinant protein
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L. monocytogenes and methicillin-resistant S. aureus. Regulates keratinocyte proliferation and differentiation after skin injury
References
Structure, chromosomal localization and expression of mouse genes encoding type III Reg, RegIII alpha, RegIII beta, RegIII gamma.Narushima Y., Unno M., Nakagawara K., Mori M., Miyashita H., Suzuki Y., Noguchi N., Takasawa S., Kumagai T., Yonekura H., Okamoto H.Gene 185:159-168(1997) Regulation of C-type lectin antimicrobial activity by a flexible N-terminal prosegment.Mukherjee S., Partch C.L., Lehotzky R.E., Whitham C.V., Chu H., Bevins C.L., Gardner K.H., Hooper L.V.J. Biol. Chem. 284:4881-4888(2009) Refolding, purification, and characterization of human and murine RegIII proteins expressed in Escherichia coli.Cash H.L., Whitham C.V., Hooper L.V.Protein Expr. Purif. 48:151-159(2006) Symbiotic bacteria direct expression of an intestinal bactericidal lectin.Cash H.L., Whitham C.V., Behrendt C.L., Hooper L.V.Science 313:1126-1130(2006) MyD88-mediated signals induce the bactericidal lectin RegIII gamma and protect mice against intestinal Listeria monocytogenes infection.Brandl K., Plitas G., Schnabl B., De;Matteo R.P., Pamer E.G.J. Exp. Med. 204:1891-1900(2007) The antibacterial lectin RegIIIgamma promotes the spatial segregation of microbiota and host in the intestine.Vaishnava S., Yamamoto M., Severson K.M., Ruhn K.A., Yu X., Koren O., Ley R., Wakeland E.K., Hooper L.V.Science 334:255-258(2011) The antimicrobial protein REG3A regulates keratinocyte proliferation and differentiation after skin injury.Lai Y., Li D., Li C., Muehleisen B., Radek K.A., Park H.J., Jiang Z., Li Z., Lei H., Quan Y., Zhang T., Wu Y., Kotol P., Morizane S., Hata T.R., Iwatsuki K., Tang C., Gallo R.L.Immunity 37:74-84(2012) Innate Stat3-mediated induction of the antimicrobial protein Reg3gamma is required for host defense against MRSA pneumonia.Choi S.M., McAleer J.P., Zheng M., Pociask D.A., Kaplan M.H., Qin S., Reinhart T.A., Kolls J.K.J. Exp. Med. 210:551-561(2013)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.3 kDa
NCBI Official Full Name
regenerating islet-derived protein 3-gamma
NCBI Official Synonym Full Names
regenerating islet-derived 3 gamma
NCBI Official Symbol
Reg3g
NCBI Official Synonym Symbols
AI449515
NCBI Protein Information
regenerating islet-derived protein 3-gamma
UniProt Protein Name
Regenerating islet-derived protein 3-gamma
UniProt Gene Name
Reg3g
UniProt Synonym Gene Names
Pap3; REG-3-gamma; Reg III-gamma
UniProt Entry Name
REG3G_MOUSE

Similar Products

Product Notes

The Reg3g reg3g (Catalog #AAA115770) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-174. Partial-length. The amino acid sequence is listed below: EVAKKDAPSS RSSCPKGSRA YGSYCYALFS VSKNWYDADM ACQKRPSGHL VSVLSGAEAS FLSSMIKSSG NSGQYVWIGL HDPTLGYEPN RGGWEWSNAD VMNYINWETN PSSSSGNHCG TLSRASGFLK WRENYCNLEL PYVCKFKA. It is sometimes possible for the material contained within the vial of "Regenerating islet-derived protein 3-gamma, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.