Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18725_SDS_PAGE.jpg SDS-PAGE

Transcription factor p65 Recombinant Protein | NFKB3 recombinant protein

Recombinant Human Transcription factor p65 protein

Average rating 0.0
No ratings yet
Gene Names
RELA; p65; NFKB3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription factor p65; N/A; Recombinant Human Transcription factor p65 protein; Nuclear factor NF-kappa-B p65 subunit; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3; NFKB3 recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-210aa; Partial
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGD
Sequence Length
210
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18725_SDS_PAGE.jpg SDS-PAGE
Related Product Information for NFKB3 recombinant protein
NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52 and the heterodimeric p65-p50 complex appears to be most abundant one. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with mbers of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kappa-B p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of I-kappa-B upon NF-kappa-B the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. Associates with chromatin at the NF-kappa-B promoter region via association with DDX1. Essential for cytokine gene expression in T-cells
Product Categories/Family for NFKB3 recombinant protein
References
Isolation of a rel-related human cDNA that potentially encodes the 65-kD subunit of NF-kappa B.Ruben S.M., Dillon P.J., Schreck R., Henkel T., Chen C.-H., Maher M., Baeuerle P.A., Rosen C.A.Science 251:1490-1493(1991) Genomic organization of the gene encoding the p65 subunit of NF-kappa B multiple variants of the p65 protein may be generated by alternative splicing.Deloukas P., van Loon A.P.G.M.Hum. Mol. Genet. 2:1895-1900(1993) An alternatively spliced transcript, p65 delta 2, of the gene encoding the p65 subunit of the transcription factor NF-kappa B.Lyle R., Valleley E.M., Sharpe P.T., Hewitt J.E.Gene 138:265-266(1994) SeattleSNPs variation discovery resourceFunctional characterization of the NF-kappa B p65 transcriptional activator and an alternatively spliced derivative.Ruben S.M., Narayanan R., Klement J.F., Chen C.-H., Rosen C.A.Mol. Cell. Biol. 12:444-454(1992) A novel complex between the p65 subunit of NF-kappa B and c-Rel binds to a DNA element involved in the phorbol ester induction of the human urokinase gene.Hansen S.K., Nerlov C., Zabel U., Verde P., Johnsen M., Baeuerle P.A., Blasi F.EMBO J. 11:205-213(1992) I kappa B/MAD-3 masks the nuclear localization signal of NF-kappa B p65 and requires the transactivation domain to inhibit NF-kappa B p65 DNA binding.Ganchi P.A., Sun S.C., Greene W.C., Ballard D.W.Mol. Biol. Cell 3:1339-1352(1992) Activation of multiple NF-kappa B/Rel DNA-binding complexes by tumor necrosis factor.Beg A.A., Baldwin A.S. Jr.Oncogene 9:1487-1492(1994) Regulation of intercellular adhesion molecule-1 gene by tumor necrosis factor-alpha is mediated by the nuclear factor-kappaB heterodimers p65/p65 and p65/c-Rel in the absence of p50.Aoudjit F., Brochu N., Belanger B., Stratowa C., Hiscott J., Audette M.Cell Growth Differ. 8:335-342(1997) A new member of the IkappaB protein family, IkappaB epsilon, inhibits RelA (p65) -mediated NF-kappaB transcription.Li Z., Nabel G.J.Mol. Cell. Biol. 17:6184-6190(1997) IKAP is a scaffold protein of the IkappaB kinase complex.Cohen L., Henzel W.J., Baeuerle P.A.Nature 395:292-296(1998) IkappaB kinases phosphorylate NF-kappaB p65 subunit on serine 536 in the transactivation domain.Sakurai H., Chiba H., Miyoshi H., Sugita T., Toriumi W.J. Biol. Chem. 274:30353-30356(1999) NF-kappaB subunit p65 binds to 53BP2 and inhibits cell death induced by 53BP2.Yang J.-P., Hori M., Takahashi N., Kawabe T., Kato H., Okamoto T.Oncogene 18:5177-5186(1999) Yersinia enterocolitica invasin protein triggers IL-8 production in epithelial cells via activation of Rel p65-p65 homodimers.Schulte R., Grassl G.A., Preger S., Fessele S., Jacobi C.A., Schaller M., Nelson P.J., Autenrieth I.B.FASEB J. 14:1471-1484(2000) Inhibition of nuclear factor-kappaB-mediated transcription by association with the amino-terminal enhancer of split, a Groucho-related protein lacking WD40 repeats.Tetsuka T., Uranishi H., Imai H., Ono T., Sonta S., Takahashi N., Asamitsu K., Okamoto T.J. Biol. Chem. 275:4383-4390(2000) Tumor necrosis factor alpha-induced phosphorylation of RelA/p65 on Ser529 is controlled by casein kinase II.Wang D., Westerheide S.D., Hanson J.L., Baldwin A.S. Jr.J. Biol. Chem. 275:32592-32597(2000) The tumor suppressor protein menin interacts with NF-kappaB proteins and inhibits NF-kappaB-mediated transactivation.Heppner C., Bilimoria K.Y., Agarwal S.K., Kester M., Whitty L.J., Guru S.C., Chandrasekharappa S.C., Collins F.S., Spiegel A.M., Marx S.J., Burns A.L.Oncogene 20:4917-4925(2001) Duration of nuclear NF-kappaB action regulated by reversible acetylation.Chen L.F., Fischle W., Verdin E., Greene W.C.Science 293:1653-1657(2001) A novel protein overexpressed in hepatoma accelerates export of NF-kappa B from the nucleus and inhibits p53-dependent apoptosis.Higashitsuji H., Higashitsuji H., Nagao T., Nonoguchi K., Fujii S., Itoh K., Fujita J.Cancer Cell 2:335-346(2002) Acetylation of RelA at discrete sites regulates distinct nuclear functions of NF-kappaB.Chen L.F., Mu Y., Greene W.C.EMBO J. 21:6539-6548(2002) The phosphorylation status of nuclear NF-kappa B determines its association with CBP/p300 or HDAC-1.Zhong H., May M.J., Jimi E., Ghosh S.Mol. Cell 9:625-636(2002) Transcriptional activation of the NF-kappaB p65 subunit by mitogen- and stress-activated protein kinase-1 (MSK1) .Vermeulen L., De Wilde G., Van Damme P., Vanden Berghe W., Haegeman G.EMBO J. 22:1313-1324(2003) Post-activation turn-off of NF-kappa B-dependent transcription is regulated by acetylation of p65.Kiernan R., Bres V., Ng R.W., Coudart M.-P., El Messaoudi S., Sardet C., Jin D.-Y., Emiliani S., Benkirane M.J. Biol. Chem. 278:2758-2766(2003) RING finger protein AO7 supports NF-kappaB-mediated transcription by interacting with the transactivation domain of the p65 subunit.Asamitsu K., Tetsuka T., Kanazawa S., Okamoto T.J. Biol. Chem. 278:26879-26887(2003) Glycogen synthase kinase-3 beta regulates NF-kappa B1/p105 stability.Demarchi F., Bertoli C., Sandy P., Schneider C.J. Biol. Chem. 278:39583-39590(2003) Regulation of NF-kappaB signaling by Pin1-dependent prolyl isomerization and ubiquitin-mediated proteolysis of p65/RelA.Ryo A., Suizu F., Yoshida Y., Perrem K., Liou Y.C., Wulf G., Rottapel R., Yamaoka S., Lu K.P.Mol. Cell 12:1413-1426(2003) Identification of a ZU5 and death domain-containing inhibitor of NF-kappaB.Zhang J., Xu L.-G., Han K.-J., Shu H.-B.J. Biol. Chem. 279:17819-17825(2004) Suppression of MEK/ERK signaling pathway enhances cisplatin-induced NF-kappaB activation by protein phosphatase 4-mediated NF-kappaB p65 Thr dephosphorylation.Yeh P.Y., Yeh K.H., Chuang S.E., Song Y.C., Cheng A.L.J. Biol. Chem. 279:26143-26148(2004) Degradation of promoter-bound p65/RelA is essential for the prompt termination of the nuclear factor kappaB response.Saccani S., Marazzi I., Beg A.A., Natoli G.J. Exp. Med. 200:107-113(2004) Identification of beta-arrestin2 as a G protein-coupled receptor-stimulated regulator of NF-kappaB pathways.Gao H., Sun Y., Wu Y., Luan B., Wang Y., Qu B., Pei G.Mol. Cell 14:303-317(2004) The candidate tumour suppressor protein ING4 regulates brain tumour growth and angiogenesis.Garkavtsev I., Kozin S.V., Chernova O., Xu L., Winkler F., Brown E., Barnett G.H., Jain R.K.Nature 428:328-332(2004) Regulation of NF-kappaB and p53 through activation of ATR and Chk1 by the ARF tumour suppressor.Rocha S., Garrett M.D., Campbell K.J., Schumm K., Perkins N.D.EMBO J. 24:1157-1169(2005) IKKbeta phosphorylates p65 at S468 in transactivation domain 2.Schwabe R.F., Sakurai H.FASEB J. 19:1758-1760(2005) cis-acting, element-specific transcriptional activity of differentially phosphorylated nuclear factor-kappa B.Anrather J., Racchumi G., Iadecola C.J. Biol. Chem. 280:244-252(2005) COMMD proteins, a novel family of structural and functional homologs of MURR1.Burstein E., Hoberg J.E., Wilkinson A.S., Rumble J.M., Csomos R.A., Komarck C.M., Maine G.N., Wilkinson J.C., Mayo M.W., Duckett C.S.J. Biol. Chem. 280:22222-22232(2005) NF-kappaB RelA phosphorylation regulates RelA acetylation.Chen L.F., Williams S.A., Mu Y., Nakano H., Duerr J.M., Buckbinder L., Greene W.C.Mol. Cell. Biol. 25:7966-7975(2005) Foxp3 interacts with nuclear factor of activated T cells and NF-kappa B to repress cytokine gene expression and effector functions of T helper cells.Bettelli E., Dastrange M., Oukka M.Proc. Natl. Acad. Sci. U.S.A. 102:5138-5143(2005) Respiratory syncytial virus M2-1 protein induces the activation of nuclear factor kappa B.Reimers K., Buchholz K., Werchau H.Virology 331:260-268(2005) Activation of the nuclear factor kappaB pathway by astrocyte elevated gene-1 implications for tumor progression and metastasis.Emdad L., Sarkar D., Su Z.-Z., Randolph A., Boukerche H., Valerie K., Fisher P.B.Cancer Res. 66:1509-1516(2006) Human ubiquitin specific protease 31 is a deubiquitinating enzyme implicated in activation of nuclear factor-kappaB.Tzimas C., Michailidou G., Arsenakis M., Kieff E., Mosialos G., Hatzivassiliou E.G.Cell. Signal. 18:83-92(2006) Inducible phosphorylation of NF-kappa B p65 at serine 468 by T cell costimulation is mediated by IKK epsilon.Mattioli I., Geng H., Sebald A., Hodel M., Bucher C., Kracht M., Schmitz M.L.J. Biol. Chem. 281:6175-6183(2006) Breast cancer metastasis suppressor 1 functions as a corepressor by enhancing histone deacetylase 1-mediated deacetylation of RelA/p65 and promoting apoptosis.Liu Y., Smith P.W., Jones D.R.Mol. Cell. Biol. 26:8683-8696(2006) Coactivator-associated arginine methyltransferase-1 enhances nuclear factor-kappaB-mediated gene transcription through methylation of histone H3 at arginine 17.Miao F., Li S., Chavez V., Lanting L., Natarajan R.Mol. Endocrinol. 20:1562-1573(2006) IL-1 receptor-associated kinase 1 is critical for latent membrane protein 1-induced p65/RelA serine 536 phosphorylation and NF-kappaB activation.Song Y.J., Jen K.Y., Soni V., Kieff E., Cahir-McFarland E.Proc. Natl. Acad. Sci. U.S.A. 103:2689-2694(2006) Nine-amino-acid transactivation domain establishment and prediction utilities.Piskacek S., Gregor M., Nemethova M., Grabner M., Kovarik P., Piskacek M.Genomics 89:756-768(2007) UXT is a novel and essential cofactor in the NF-kappaB transcriptional enhanceosome.Sun S., Tang Y., Lou X., Zhu L., Yang K., Zhang B., Shi H., Wang C.J. Cell Biol. 178:231-244(2007) The familial Mediterranean fever protein, pyrin, is cleaved by caspase-1 and activates NF-kappaB through its N-terminal fragment.Chae J.J., Wood G., Richard K., Jaffe H., Colburn N.T., Masters S.L., Gumucio D.L., Shoham N.G., Kastner D.L.Blood 112:1794-1803(2008) Functional characterization of the atopy-associated gene PHF11.Clarke E., Rahman N., Page N., Rolph M.S., Stewart G.J., Jones G.J.J. Allergy Clin. Immunol. 121:1148-1154(2008) AKIP1 enhances NF-kappaB-dependent gene expression by promoting the nuclear retention and phosphorylation of p65.Gao N., Asamitsu K., Hibi Y., Ueno T., Okamoto T.J. Biol. Chem. 283:7834-7843(2008) The DEAD-box RNA helicase DDX1 interacts with RelA and enhances nuclear factor kappaB-mediated transcription.Ishaq M., Ma L., Wu X., Mu Y., Pan J., Hu J., Hu T., Fu Q., Guo D.J. Cell. Biochem. 106:296-305(2009) Brd4 coactivates transcriptional activation of NF-kappaB via specific binding to acetylated RelA.Huang B., Yang X.D., Zhou M.M., Ozato K., Chen L.F.Mol. Cell. Biol. 29:1375-1387(2009) Lysine acetylation targets protein complexes and co-regulates major cellular functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009) A novel LZAP-binding protein, NLBP, inhibits cell invasion.Kwon J., Cho H.J., Han S.H., No J.G., Kwon J.Y., Kim H.J. Biol. Chem. 285:12232-12240(2010) SIRT2 regulates NF-kappaB dependent gene expression through deacetylation of p65 Lys310.Rothgiesser K.M., Erener S., Waibel S., Luscher B., Hottiger M.O.J. Cell Sci. 123:4251-4258(2010) Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65.Sharif-Askari E., Vassen L., Kosan C., Khandanpour C., Gaudreau M.C., Heyd F., Okayama T., Jin J., Rojas M.E., Grimes H.L., Zeng H., Moroy T.Mol. Cell. Biol. 30:3929-3942(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) NF-kappaB repression by PIAS3 mediated RelA SUMOylation.Liu Y., Bridges R., Wortham A., Kulesz-Martin M.PLoS ONE 7:E37636-E37636(2012) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) C11orf95-RELA fusions drive oncogenic NF-kappaB signalling in ependymoma.Parker M., Mohankumar K.M., Punchihewa C., Weinlich R., Dalton J.D., Li Y., Lee R., Tatevossian R.G., Phoenix T.N., Thiruvenkatam R., White E., Tang B., Orisme W., Gupta K., Rusch M., Chen X., Li Y., Nagahawhatte P. , Hedlund E., Finkelstein D., Wu G., Shurtleff S., Easton J., Boggs K., Yergeau D., Vadodaria B., Mulder H.L., Becksfort J., Becksford J., Gupta P., Huether R., Ma J., Song G., Gajjar A., Merchant T., Boop F., Smith A.A., Ding L., Lu C., Ochoa K., Zhao D., Fulton R.S., Fulton L.L., Mardis E.R., Wilson R.K., Downing J.R., Green D.R., Zhang J., Ellison D.W., Gilbertson R.J.Nature 506:451-455(2014) Structure of an IkappaBalpha/NF-kappaB complex.Jacobs M.D., Harrison S.C.Cell 95:749-758(1998) +Additional computationally mapped references.<p>Provides general information on the entry.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.7kD
NCBI Official Full Name
transcription factor p65 isoform 2
NCBI Official Synonym Full Names
v-rel avian reticuloendotheliosis viral oncogene homolog A
NCBI Official Symbol
RELA
NCBI Official Synonym Symbols
p65; NFKB3
NCBI Protein Information
transcription factor p65
UniProt Protein Name
Transcription factor p65
UniProt Gene Name
RELA
UniProt Synonym Gene Names
NFKB3
UniProt Entry Name
TF65_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NFKB3 rela (Catalog #AAA18725) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-210aa; Partial. The amino acid sequence is listed below: MDELFPLIFP AEPAQASGPY VEIIEQPKQR GMRFRYKCEG RSAGSIPGER STDTTKTHPT IKINGYTGPG TVRISLVTKD PPHRPHPHEL VGKDCRDGFY EAELCPDRCI HSFQNLGIQC VKKRDLEQAI SQRIQTNNNP FQVPIEEQRG DYDLNAVRLC FQVTVRDPSG RPLRLPPVLS HPIFDNRAPN TAELKICRVN RNSGSCLGGD. It is sometimes possible for the material contained within the vial of "Transcription factor p65, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.