Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA235212_SDS_PAGE15.jpg SDS-PAGE

Renin-2 (Ren2) Recombinant Protein | Ren2 recombinant protein

Recombinant Mouse Renin-2 (Ren2), partial

Gene Names
Ren2; Ren; Rnr; Rn-2; Ren-2; Ren-B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Renin-2 (Ren2); N/A; Recombinant Mouse Renin-2 (Ren2), partial; ChemerinRAR-responsive protein TIG2Tazarotene-induced gene 2 protein; Ren2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Sequence Positions
64-351. Partial
Sequence
SSLTDLISPVVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGDDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAQFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEKVFSVYYNRGPHLLGGEVVLGGSDPEHYQGDFHYVSLSKTDSWQITMKGVSVGSSTLLCEEGCEVVVDTGSSFISAPTSSLKLIMQALGAKEKRLHEYVVSCSQVPTLPDISFNLGGRAYTLSSTDYVLQYPN
Organism
Mus musculus (Mouse)
Tag Information
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

product-image-AAA235212_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Ren2 recombinant protein
Adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chokine receptor-like 2 (CCRL2). Positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. Also acts as a proinflammatory adipokine, causing an increase in secretion of proinflammatory and prodiabetic adipokines, which further impair adipose tissue metabolic function and have negative systic effects including impaired insulin sensitivity, altered glucose and lipid metabolism, and a decrease in vascular function in other tissues. Can have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. Acts as a chotactic factor for leukocyte populations expressing CMKLR1, particularly immature plasmacytoid dendritic cells, but also immature myeloid DCs, macrophages and natural killer cells. Exerts an anti-inflammatory role by preventing TNF/TNFA-induced VCAM1 expression and monocytes adhesion in vascular endothelial cells. The effect is mediated via inhibiting activation of NF-kappa-B and CRK/p38 through stimulation of AKT1/NOS3 signaling and nitric oxide production. Its dual role in inflammation and metabolism might provide a link between chronic inflammation and obesity, as well as obesity-related disorders such as type 2 diabetes and cardiovascular disease. Exhibits an antimicrobial function in the skin.
Product Categories/Family for Ren2 recombinant protein
References
A tissue-specific atlas of mouse protein phosphorylation and expression.Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189 (2010)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
renin-2
NCBI Official Synonym Full Names
renin 2 tandem duplication of Ren1
NCBI Official Symbol
Ren2
NCBI Official Synonym Symbols
Ren; Rnr; Rn-2; Ren-2; Ren-B
NCBI Protein Information
renin-2
UniProt Protein Name
Renin-2
UniProt Gene Name
Ren2
UniProt Synonym Gene Names
Ren-2

Similar Products

Product Notes

The Ren2 ren2 (Catalog #AAA235212) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 64-351. Partial with tag N-terminal 6xHis-tagged. The amino acid sequence is listed below: SSLTDLISPV VLTNYLNSQY YGEIGIGTPP QTFKVIFDTG SANLWVPSTK CSRLYLACGI HSLYESSDSS SYMENGDDFT IHYGSGRVKG FLSQDSVTVG GITVTQTFGE VTELPLIPFM LAQFDGVLGM GFPAQAVGGV TPVFDHILSQ GVLKEKVFSV YYNRGPHLLG GEVVLGGSDP EHYQGDFHYV SLSKTDSWQI TMKGVSVGSS TLLCEEGCEV VVDTGSSFIS APTSSLKLIM QALGAKEKRL HEYVVSCSQV PTLPDISFNL GGRAYTLSST DYVLQYPN. It is sometimes possible for the material contained within the vial of "Renin-2 (Ren2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.