Rho guanine nucleotide exchange factor 18 Recombinant Protein | ARHGEF18 recombinant protein
Recombinant Human Rho guanine nucleotide exchange factor 18
Gene Names
RHO; RP4; OPN2; CSNBAD1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Rho guanine nucleotide exchange factor 18; N/A; Recombinant Human Rho guanine nucleotide exchange factor 18; Opsin-2; ARHGEF18 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-36aa; Partial
Sequence
MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQ
Sequence Length
348
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for ARHGEF18 recombinant protein
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal.
Product Categories/Family for ARHGEF18 recombinant protein
References
"Isolation and nucleotide sequence of the gene encoding human rhodopsin." Nathans J., Hogness D.S. Proc. Natl. Acad. Sci. U.S.A. 81:4851-4855(1984)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20.2 kDa
NCBI Official Full Name
rhodopsin
NCBI Official Synonym Full Names
rhodopsin
NCBI Official Symbol
RHO
NCBI Official Synonym Symbols
RP4; OPN2; CSNBAD1
NCBI Protein Information
rhodopsin
UniProt Protein Name
Rhodopsin
UniProt Gene Name
RHO
UniProt Synonym Gene Names
OPN2
UniProt Entry Name
OPSD_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ARHGEF18 rho (Catalog #AAA113126) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-36aa; Partial. The amino acid sequence is listed below: MNGTEGPNFY VPFSNATGVV RSPFEYPQYY LAEPWQ. It is sometimes possible for the material contained within the vial of "Rho guanine nucleotide exchange factor 18, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
