Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113522_SDS_PAGE15.jpg SDS-PAGE (Rat Prorelaxin 1 (Rln1)No tagged;Tag removed (Additional charge required for tag removal service fee. Please inquire)E.coli derived)

Prorelaxin 1 (Rln1) Recombinant Protein | Rln1 recombinant protein

Recombinant Rat Prorelaxin 1 (Rln1), partial

Gene Names
Rln1; RELAX
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prorelaxin 1 (Rln1); N/A; Recombinant Rat Prorelaxin 1 (Rln1), partial; Rln1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-57aa, Cytoplasmic domain
Sequence
RVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLAL
Sequence Length
186
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

(Rat Prorelaxin 1 (Rln1)No tagged;Tag removed (Additional charge required for tag removal service fee. Please inquire)E.coli derived)

product-image-AAA113522_SDS_PAGE15.jpg SDS-PAGE (Rat Prorelaxin 1 (Rln1)No tagged;Tag removed (Additional charge required for tag removal service fee. Please inquire)E.coli derived)
Related Product Information for Rln1 recombinant protein
Relaxins are known endocrine and autocrine
paracrine hormones, belonging to the insulin gene superfamily. In the human there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3. RLN1 and RLN2 share high sequence homology. This encoded protein is synthesized as a single-chain polypeptide but the active form consists of an A chain and a B chain linked by disulfide bonds; however, their exact cleavage sites have not been described. Relaxin is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additional roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin. This gene has multiple polyadenylation sites. There are multiple alternatively spliced transcript variants described for this gene but their full length nature is not known yet.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,489 Da
NCBI Official Full Name
prorelaxin 1
NCBI Official Synonym Full Names
relaxin 1
NCBI Official Symbol
Rln1
NCBI Official Synonym Symbols
RELAX
NCBI Protein Information
prorelaxin 1
UniProt Protein Name
Prorelaxin 1
UniProt Gene Name
Rln1
UniProt Synonym Gene Names
Rln

Similar Products

Product Notes

The Rln1 rln1 (Catalog #AAA113522) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-57aa, Cytoplasmic domain. The amino acid sequence is listed below: RVSEEWMDQV IQVCGRGYAR AWIEVCGASV GRLAL. It is sometimes possible for the material contained within the vial of "Prorelaxin 1 (Rln1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.