Hydrophobin (rodA) Recombinant Protein | rodA recombinant protein
Recombinant Neosartorya fumigata Hydrophobin (rodA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hydrophobin (rodA); N/A; Recombinant Neosartorya fumigata Hydrophobin (rodA); Rodlet protein; rodA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-159aa; Full Length of Mature Protein
Sequence
LPQHDVNAAGNGVGNKGNANVRFPVPDDITVKQATEKCGDQAQLSCCNKATYAGDVTDIDEGILAGTLKNLIGGGSGTEGLGLFNQCSKLDLQIPVIGIPIQALVNQKCKQNIACCQNSPSDASGSLIGLGLPCIALGSIL
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for rodA recombinant protein
Cell wall protein regularly arranged in interwoven fascicules of clustered proteinaceous microfibrils, or rodlets, to form the outer spore coat protein. It is involved in resistance to environmental stress and may well be associated with conidial hydrophobicity. It is important in the morphogenesis of the dispersible conidia.
References
Rodletless mutants of Aspergillus fumigatus.Thau N., Monod M., Crestani B., Rolland C., Tronchin G., Latge J.-P., Paris S.Infect. Immun. 62:4380-4388(1994) ErratumThau N., Monod M., Crestani B., Rolland C., Tronchin G., Latge J.-P., Paris S.Infect. Immun. 62:5706-5706(1994) HYP1, a hydrophobin gene from Aspergillus fumigatus, complements the rodletless phenotype in Aspergillus nidulans.Parta M., Chang Y., Rulong S., Pinto-Dasilva P., Kwon-Chung K.J.Infect. Immun. 62:4389-4395(1994) Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus.Nierman W.C., Pain A., Anderson M.J., Wortman J.R., Kim H.S., Arroyo J., Berriman M., Abe K., Archer D.B., Bermejo C., Bennett J.W., Bowyer P., Chen D., Collins M., Coulsen R., Davies R., Dyer P.S., Farman M.L., Fedorova N., Fedorova N.D., Feldblyum T.V., Fischer R., Fosker N., Fraser A., Garcia J.L., Garcia M.J., Goble A., Goldman G.H., Gomi K., Griffith-Jones S., Gwilliam R., Haas B.J., Haas H., Harris D.E., Horiuchi H., Huang J., Humphray S., Jimenez J., Keller N., Khouri H., Kitamoto K., Kobayashi T., Konzack S., Kulkarni R., Kumagai T., Lafton A., Latge J.-P., Li W., Lord A., Lu C., Majoros W.H., May G.S., Miller B.L., Mohamoud Y., Molina M., Monod M., Mouyna I., Mulligan S., Murphy L.D., O'Neil S., Paulsen I., Penalva M.A., Pertea M., Price C., Pritchard B.L., Quail M.A., Rabbinowitsch E., Rawlins N., Rajandream M.A., Reichard U., Renauld H., Robson G.D., Rodriguez de Cordoba S., Rodriguez-Pena J.M., Ronning C.M., Rutter S., Salzberg S.L., Sanchez M., Sanchez-Ferrero J.C., Saunders D., Seeger K., Squares R., Squares S., Takeuchi M., Tekaia F., Turner G., Vazquez de Aldana C.R., Weidman J., White O., Woodward J.R., Yu J.-H., Fraser C.M., Galagan J.E., Asai K., Machida M., Hall N., Barrell B.G., Denning D.W.Nature 438:1151-1156(2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16.3 kDa
NCBI Official Full Name
conidial hydrophobin Hyp1/RodA
NCBI Official Symbol
AFUA_5G09580
NCBI Protein Information
conidial hydrophobin Hyp1/RodA
UniProt Protein Name
Hydrophobin
UniProt Gene Name
rodA
UniProt Synonym Gene Names
hyp1
UniProt Entry Name
RODL_ASPFU
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The rodA roda (Catalog #AAA114583) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-159aa; Full Length of Mature Protein. The amino acid sequence is listed below: LPQHDVNAAG NGVGNKGNAN VRFPVPDDIT VKQATEKCGD QAQLSCCNKA TYAGDVTDID EGILAGTLKN LIGGGSGTEG LGLFNQCSKL DLQIPVIGIP IQALVNQKCK QNIACCQNSP SDASGSLIGL GLPCIALGSI L. It is sometimes possible for the material contained within the vial of "Hydrophobin (rodA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
