Rotavirus VP4 Recombinant Protein
Rotavirus VP4 protein (His tag)
Purity
>90% pure by SDS-PAGE
Synonyms
Rotavirus VP4; N/A; Rotavirus VP4 protein (His tag); Glycoprotein VP4 protein; Rotavirus protein; VP4 protein; Outer capsid glycoprotein VP4; Rotavirus VP4 recombinant protein
Host
E. coli
Purity/Purification
>90% pure by SDS-PAGE
Concentration
0.5 mg/mL (varies by lot)
Sequence
AQVSEDIIISKTSLWKEMQYNRDIIIRFKFNNSIIKLGGLGYKWSEISF KAANYQYNYLRDGEQVTAHTTCSVNGVNNFSYNGGLLPTHFSISRYE VIKENSYVYVDYWDDSQAFRNMVYVRSLAANLNSVKCSGGNYNFQ MPVGAWPVMSGGAVSLHFAGVTLSTQFTDFVSLNSLRFRFSLTVEEP PFSILRTRVSGLYGLPASNPNSGHEYYEIAGRFSLISLVPSNDDY
Application Notes
Expression Region: 247-479aa partial sequenceof protein N-Terminal 6X His-SUMO-tagged.
Protein Type
Recombinant
Species
Human
Form
Supplied lyophilized in 10mM Tris-HCI, pH 8.0, 1 mM EDT A with 6% Trehalose. Reconstitute with sterile laboratory grade water to a concentration of 0.1 to 1 mg/ml and use immediately. For longer term storage in liquid form, add glycerol @ 5 to 50% final concentration. (50% recommended)
Tag/Conjugate
His tag
Biohazard
Recombinant protein with His-tag. Use standard laboratory precautions when handling this material.
Biological Significance
VP4 an outer capsid proteins, induces neutralizing antibodies and is responsible for Rotavirus serotype specificity.
Preparation and Storage
Upon receipt store at -20°C to -80°C. Once reconstituted use within 6 months of reconstitution. Avoid repeated freeze thaws of reconstituted product.
Related Product Information for Rotavirus VP4 recombinant protein
Purified recombinant Rotavirus VP4 protein (His tag)
VP4 an outer capsid proteins, induces neutralizing antibodies and is responsible for Rotavirus serotype specificity.
VP4 an outer capsid proteins, induces neutralizing antibodies and is responsible for Rotavirus serotype specificity.
Product Categories/Family for Rotavirus VP4 recombinant protein
Similar Products
Product Notes
The Rotavirus VP4 (Catalog #AAA24011) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. Expression Region: 247-479aa partial sequenceof protein N-Terminal 6X His-SUMO-tagged. Researchers should empirically determine the suitability of the Rotavirus VP4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AQVSEDIIIS KTSLWKEMQY NRDIIIRFKF NNSIIKLGGL GYKWSEISF KAANYQYNYL RDGEQVTAHT TCSVNGVNNF SYNGGLLPTH FSISRYE VIKENSYVYV DYWDDSQAFR NMVYVRSLAA NLNSVKCSGG NYNFQ MPVGAWPVMS GGAVSLHFAG VTLSTQFTDF VSLNSLRFRF SLTVEEP PFSILRTRVS GLYGLPASNP NSGHEYYEIA GRFSLISLVP SNDDY . It is sometimes possible for the material contained within the vial of "Rotavirus VP4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.