Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Rotavirus VP7 Recombinant Protein

Rotavirus VP7 protein (His tag)

Average rating 0.0
No ratings yet
Purity
>90% by SDS-PAGE
Synonyms
Rotavirus VP7; N/A; Rotavirus VP7 protein (His tag); Glycoprotein VP7 protein; Rotavirus protein; VP7 protein; Outer capsid glycoprotein VP7; Rotavirus VP7 recombinant protein
Ordering
Purity/Purification
>90% by SDS-PAGE
Form/Format
Supplied lyophilized in 10 mM Tris-HCl, pH 8.0, 1 mM EDTA with 6% Trehalose. Reconstitute with sterile laboratory grade water to a concentration of 0.1 to 1mg/ml. If storing in liquid form, add glycerol @ 5 to 50% final concentration. (50% recommended)
Concentration
Lyophilized, 100ug (varies by lot)
Sequence
Residues: QNYGINLPITGSMDTAYANSTQDNNFLFSTLCLYYPSEAPTQISDTEWKDTLS QLFLTKGWPTGSVYFNEYSNVLEFSIDPKLYCDYNVVLIRFVSGEELDISELADL ILNEWLCNPMDITLYYYQQTGEANKWISMGSSCTVKVCPLNTQTLGIGCQT TNTATFETVADSEKLAIIDVVDSVNHKLNITSTTCTIRNCNKLGPRENVAIIQVG GSNILDITADPTTSPQTERMMRVNWKKWWQVFYTVVDYINQIVQVMSKR SRSLDSSSFYYRV
Source
E. coli
Species
Human
Tag
His-tag.
Grade
Recombinant
Expression Region
51-326aa
Biohazard
Recombinant protein with His-Tag. Use standard laboratory precautions when handling this material.
Biological Significance
VP7 is a major capsid glycoprotein found in rotavirus. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. In integrin-dependent strains, VP7 seems to essentially target the integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3 at a postbinding stage, once the initial attachment by VP4 has been achieved
Preparation and Storage
Upon receipt store at -20°C to -80°C. Once reconstituted use within 6 months of reconstitution. Avoid repeated freeze thaws of reconstituted product.
Product Categories/Family for Rotavirus VP7 recombinant protein

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Rotavirus VP7 (Catalog #AAA224564) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: Residues: QNYGINLPIT GSMDTAYANS TQDNNFLFST LCLYYPSEAP TQISDTEWKD TLS QLFLTKGWPT GSVYFNEYSN VLEFSIDPKL YCDYNVVLIR FVSGEELDIS ELADL ILNEWLCNPM DITLYYYQQT GEANKWISMG SSCTVKVCPL NTQTLGIGCQ T TNTATFETVA DSEKLAIIDV VDSVNHKLNI TSTTCTIRNC NKLGPRENVA IIQVG GSNILDITAD PTTSPQTERM MRVNWKKWWQ VFYTVVDYIN QIVQVMSKR SRSLDSSSFY YRV. It is sometimes possible for the material contained within the vial of "Rotavirus VP7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.