Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA81635_SDS_PAGE15.jpg SDS-PAGE

50S ribosomal protein L31 Recombinant Protein | L31 recombinant protein

Recombinant E Coli 50S ribosomal protein L31

Average rating 0.0
No ratings yet
Gene Names
rpmE; ECK3928; JW3907
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
50S ribosomal protein L31; N/A; Recombinant E Coli 50S ribosomal protein L31; L31 recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-70aa; Full Length
Sequence
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRFNIPGSK
Sequence Length
70
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA81635_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for L31 recombinant protein
Binds the 23S rRNA.
References
Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes.Plunkett G. III, Burland V., Daniels D.L., Blattner F.R.Nucleic Acids Res. 21:3391-3398(1993) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Primary structure of Escherichia coli ribosomal protein L31.Brosius J.Biochemistry 17:501-508(1978) Small genes/gene-products in Escherichia coli K-12.Wasinger V.C., Humphery-Smith I.FEMS Microbiol. Lett. 169:375-382(1998) Characterization of Escherichia coli 50S ribosomal protein L31.Eistetter A.J., Butler P.D., Traut R.R., Fanning T.G.FEMS Microbiol. Lett. 180:345-349(1999) Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry.Arnold R.J., Reilly J.P.Anal. Biochem. 269:105-112(1999) Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli.Zhang J., Sprung R., Pei J., Tan X., Kim S., Zhu H., Liu C.F., Grishin N.V., Zhao Y.Mol. Cell. Proteomics 8:215-225(2009) Characterization of Zn(II) -responsive ribosomal proteins YkgM and L31 in E. coli.Hensley M.P., Gunasekera T.S., Easton J.A., Sigdel T.K., Sugarbaker S.A., Klingbeil L., Breece R.M., Tierney D.L., Crowder M.W.J. Inorg. Biochem. 111:164-172(2012) Structures of the bacterial ribosome at 3.5 A resolution.Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.Science 310:827-834(2005)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.9 kDa
NCBI Official Full Name
50S ribosomal subunit protein L31
NCBI Official Symbol
rpmE
NCBI Official Synonym Symbols
ECK3928; JW3907
NCBI Protein Information
50S ribosomal subunit protein L31
UniProt Protein Name
50S ribosomal protein L31
UniProt Gene Name
rpmE
UniProt Entry Name
RL31_ECOLI

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The L31 rpme (Catalog #AAA81635) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-70aa; Full Length. The amino acid sequence is listed below: MKKDIHPKYE EITASCSCGN VMKIRSTVGH DLNLDVCSKC HPFFTGKQRD VATGGRVDRF NKRFNIPGSK. It is sometimes possible for the material contained within the vial of "50S ribosomal protein L31, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.