26S proteasome regulatory subunit RPN13 Recombinant Protein | RPN13 recombinant protein
Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) 26S proteasome regulatory subunit RPN13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
26S proteasome regulatory subunit RPN13; N/A; Recombinant Saccharomyces cerevisiae (strain 204508 / S288c) 26S proteasome regulatory subunit RPN13; Proteasome non-ATPase subunit 13; RPN13 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-156aa; Full-Length of the Mature Protein
Sequence
SMSSTVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLNNSSESDEEESNDEKQKAQDVDVSMQD
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for RPN13 recombinant protein
Component of the 19S cap proteasome complex which acts as a regulatory subunit of the 26S proteasome, involved in the ATP-dependent degradation of ubiquitinated proteins.
References
The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.Johnston M., Hillier L.W., Riles L., Albermann K., Andre B., Ansorge W., Benes V., Brueckner M., Delius H., Dubois E., Duesterhoeft A., Entian K.-D., Floeth M., Goffeau A., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Hilger F., Kleine K., Koetter P., Louis E.J., Messenguy F., Mewes H.-W., Miosga T., Moestl D., Mueller-Auer S., Nentwich U., Obermaier B., Piravandi E., Pohl T.M., Portetelle D., Purnelle B., Rechmann S., Rieger M., Rinke M., Rose M., Scharfe M., Scherens B., Scholler P., Schwager C., Schwarz S., Underwood A.P., Urrestarazu L.A., Vandenbol M., Verhasselt P., Vierendeels F., Voet M., Volckaert G., Voss H., Wambutt R., Wedler E., Wedler H., Zimmermann F.K., Zollner A., Hani J., Hoheisel J.D.Nature 387:87-90(1997) ) Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.Hu Y., Rolfs A., Bhullar B., Murthy T.V.S., Zhu C., Berger M.F., Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J., Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J., Simpson A.J.G., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.Genome Res. 17:536-543(2007) The 26S proteasome of the yeast Saccharomyces cerevisiae.Fischer M., Hilt W., Richter-Ruoff B., Gonen H., Ciechanover A., Wolf D.H.FEBS Lett. 355:69-75(1994)
NCBI and Uniprot Product Information
NCBI GeneID
Molecular Weight
33.8 kDa
NCBI Official Symbol
RPN13
NCBI Protein Information
proteasome regulatory particle lid subunit RPN13
UniProt Protein Name
26S proteasome regulatory subunit RPN13
UniProt Gene Name
RPN13
UniProt Synonym Gene Names
DAQ1
UniProt Entry Name
RPN13_YEAST
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The RPN13 rpn13 (Catalog #AAA114576) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-156aa; Full-Length of the Mature Protein. The amino acid sequence is listed below: SMSSTVIKFR AGVCEYNEDS RLCTPIPVQG EIEIKPNEEE ELGFWDFEWR PTEKPVGREL DPISLILIPG ETMWVPIKSS KSGRIFALVF SSNERYFFWL QEKNSGNLPL NELSAKDKEI YNKMIGVLNN SSESDEEESN DEKQKAQDVD VSMQD. It is sometimes possible for the material contained within the vial of "26S proteasome regulatory subunit RPN13, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
