40S ribosomal protein S3 Recombinant Protein | RPS3 recombinant protein

Recombinant Human 40S ribosomal protein S3

Cat. Num. AAA18406

• Gene Names: RPS3; S3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 40S ribosomal protein S3; N/A; Recombinant Human 40S ribosomal protein S3; Homo sapiens (Human); RPS3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-243aa; Full Length of Mature Protein
• Sequence: AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for RPS3 recombinant protein

Involved in translation as a component of the 40S small ribosomal subunit (PubMed:8706699). Has endonuclease activity and plays a role in repair of damaged DNA (PubMed:7775413). Cleaves phosphodiester bonds of DNAs containing altered bases with broad specificity and cleaves supercoiled DNA more efficiently than relaxed DNA (PubMed:15707971). Displays high binding affinity for 7,8-dihydro-8-oxoguanine (8-oxoG), a common DNA lesion caused by reactive oxygen species (ROS) (PubMed:14706345). Has also been shown to bind with similar affinity to intact and damaged DNA (PubMed:18610840). Stimulates the N-glycosylase activity of the base excision protein OGG1 (PubMed:15518571). Enhances the uracil excision activity of UNG1 (PubMed:18973764). Also stimulates the cleavage of the phosphodiester backbone by APEX1 (PubMed:18973764). When located in the mitochondrion, reduces cellular ROS levels and mitochondrial DNA damage (PubMed:23911537). Has also been shown to negatively regulate DNA repair in cells exposed to hydrogen peroxide (PubMed:17049931). Plays a role in regulating transcription as part of the NF-kappa-B p65-p50 complex where it binds to the RELA/p65 subunit, enhances binding of the complex to DNA and promotes transcription of target genes (PubMed:18045535). Represses its own translation by binding to its cognate mRNA (PubMed:20217897). Binds to and protects TP53/p53 from MDM2-mediated ubiquitination (PubMed:19656744). Involved in spindle formation and chromosome movement during mitosis by regulating microtubule polymerization (PubMed:23131551). Involved in induction of apoptosis through its role in activation of CASP8 (PubMed:14988002). Induces neuronal apoptosis by interacting with the E2F1 transcription factor and acting synergistically with it to up-regulate pro-apoptotic proteins BCL2L11/BIM and HRK/Dp5 (PubMed:20605787). Interacts with TRADD following exposure to UV radiation and induces apoptosis by caspase-dependent JNK activation (PubMed:22510408).

References

"Isolation of a cDNA encoding human 40S ribosomal protein s3." Zhang X.T., Tan Y.M., Tan Y.H. Nucleic Acids Res. 18:6689-6689(1990)

NCBI and Uniprot Product Information

• NCBI GI #: 15718687
• NCBI GeneID: 6188
• NCBI Accession #: NP_000996.2
• NCBI GenBank Nucleotide #: NM_001005.4
• UniProt Accession #: P23396; Q498B5; Q8NI95; B2R7N5; J3KN86
• Molecular Weight: 42.6 kDa
• NCBI Official Full Name: 40S ribosomal protein S3 isoform 1
• NCBI Official Synonym Full Names: ribosomal protein S3
• NCBI Official Symbol: RPS3
• NCBI Official Synonym Symbols: S3
• NCBI Protein Information: 40S ribosomal protein S3
• UniProt Protein Name: 40S ribosomal protein S3
• UniProt Gene Name: RPS3
• UniProt Entry Name: RS3_HUMAN