Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113922_SDS_PAGE15.jpg SDS-PAGE

S100-A9 Recombinant Protein | S100a9 recombinant protein

Recombinant Mouse Protein S100-A9

Gene Names
S100a9; p14; Cagb; GAGB; L1Ag; BEE22; MRP14; 60B8Ag; AW546964
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
S100-A9; N/A; Recombinant Mouse Protein S100-A9; Calgranulin-B; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9; S100a9 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-113. Full Length of Mature Protein
Sequence
ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA113922_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for S100a9 recombinant protein
S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinfammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, NXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif.
References
Mouse MRP8 and MRP14, two intracellular calcium-binding proteins associated with the development of the myeloid lineage.Lagasse E., Weissman I.L.Blood 79:1907-1915(1992) Molecular analysis of the mouse S100A9 gene and evidence that the myeloid specific transcription factor C/EBPepsilon is not required for the regulation of the S100A9/A8 gene expression in neutrophils.Nacken W.K.F., Lekstrom-Himes J.A., Sorg C., Manitz M.3.0.CO;2-K>J. Cell. Biochem. 80:606-616(2001) Isolation of the murine S100 protein MRP14 (14 kDa migration-inhibitory-factor-related protein) from activated spleen cells characterization of post-translational modifications and zinc binding.Raftery M.J., Harrison C.A., Alewood P.F., Jones A., Geczy C.L.Biochem. J. 316:285-293(1996) Loss of S100A9 (MRP14) results in reduced interleukin-8-induced CD11b surface expression, a polarized microfilament system, and diminished responsiveness to chemoattractants in vitro.Manitz M.-P., Horst B., Seeliger S., Strey A., Skryabin B.V., Gunzer M., Frings W., Schoenlau F., Roth J., Sorg C., Nacken W.Mol. Cell. Biol. 23:1034-1043(2003) MRP8 and MRP14 control microtubule reorganization during transendothelial migration of phagocytes.Vogl T., Ludwig S., Goebeler M., Strey A., Thorey I.S., Reichelt R., Foell D., Gerke V., Manitz M.P., Nacken W., Werner S., Sorg C., Roth J.Blood 104:4260-4268(2004) Comprehensive identification of phosphorylation sites in postsynaptic density preparations.Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.Mol. Cell. Proteomics 5:914-922(2006) Mrp8 and Mrp14 are endogenous activators of Toll-like receptor 4, promoting lethal, endotoxin-induced shock.Vogl T., Tenbrock K., Ludwig S., Leukert N., Ehrhardt C., van Zoelen M.A.D., Nacken W., Foell D., van der Poll T., Sorg C., Roth J.Nat. Med. 13:1042-1049(2007) S100A8 and S100A9 mediate endotoxin-induced cardiomyocyte dysfunction via the receptor for advanced glycation end products.Boyd J.H., Kan B., Roberts H., Wang Y., Walley K.R.Circ. Res. 102:1239-1246(2008) Anti-infective protective properties of S100 calgranulins.Hsu K., Champaiboon C., Guenther B.D., Sorenson B.S., Khammanivong A., Ross K.F., Geczy C.L., Herzberg M.C.Antiinflamm. Antiallergy Agents Med. Chem. 8:290-305(2009) Identification of human S100A9 as a novel target for treatment of autoimmune disease via binding to quinoline-3-carboxamides.Bjoerk P., Bjoerk A., Vogl T., Stenstroem M., Liberg D., Olsson A., Roth J., Ivars F., Leanderson T.PLoS Biol. 7:E97-E97(2009) Inflammation-associated S100 proteins new mechanisms that regulate function.Goyette J., Geczy C.L.Amino Acids 41:821-842(2011) S100A9 differentially modifies phenotypic states of neutrophils, macrophages, and dendritic cells implications for atherosclerosis and adipose tissue inflammation.Averill M.M., Barnhart S., Becker L., Li X., Heinecke J.W., Leboeuf R.C., Hamerman J.A., Sorg C., Kerkhoff C., Bornfeldt K.E.Circulation 123:1216-1226(2011) Induction of nuclear factor-kappaB responses by the S100A9 protein is Toll-like receptor-4-dependent.Riva M., Kaellberg E., Bjoerk P., Hancz D., Vogl T., Roth J., Ivars F., Leanderson T.Immunology 137:172-182(2012)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.9 kDa
NCBI Official Full Name
protein S100-A9
NCBI Official Synonym Full Names
S100 calcium binding protein A9 (calgranulin B)
NCBI Official Symbol
S100a9
NCBI Official Synonym Symbols
p14; Cagb; GAGB; L1Ag; BEE22; MRP14; 60B8Ag; AW546964
NCBI Protein Information
protein S100-A9
UniProt Protein Name
Protein S100-A9
UniProt Gene Name
S100a9
UniProt Synonym Gene Names
Cagb; Mrp14; MRP-14; p14
UniProt Entry Name
S10A9_MOUSE

Similar Products

Product Notes

The S100a9 s100a9 (Catalog #AAA113922) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-113. Full Length of Mature Protein. The amino acid sequence is listed below: ANKAPSQMER SITTIIDTFH QYSRKEGHPD TLSKKEFRQM VEAQLATFMK KEKRNEALIN DIMEDLDTNQ DNQLSFEECM MLMAKLIFAC HEKLHENNPR GHGHSHGKGC GK. It is sometimes possible for the material contained within the vial of "S100-A9, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.