Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Serum amyloid A-2 Recombinant Protein | Saa2 recombinant protein

Recombinant Mouse Serum amyloid A-2 protein

Gene Names
Saa2; Saa1; Saa-2; AW111173
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serum amyloid A-2; N/A; Recombinant Mouse Serum amyloid A-2 protein; Amyloid fibril protein AA; Saa2 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-122aa; Full Length of Mature Protein
Sequence
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Saa2 recombinant protein
Major acute phase reactant. Apolipoprotein of the HDL complex.
References
Structure of the murine serum amyloid A gene family. Gene conversion.Lowell C.A., Potter D.A., Stearman R.S., Morrow J.F.J. Biol. Chem. 261:8442-8452(1986) Complete primary structures of two major murine serum amyloid A proteins deduced from cDNA sequences.Yamamoto K., Migita S.Proc. Natl. Acad. Sci. U.S.A. 82:2915-2919(1985) Structural diversity of murine serum amyloid A genes. Evolutionary implications.Yamamoto K., Goto N., Kosaka J., Shiroo M., Yeul Y.D., Migita S.J. Immunol. 139:1683-1688(1987) Mouse serum amyloid A protein. Complete amino acid sequence and mRNA analysis of a new isoform.de Beer M.C., de Beer F.C., Beach C.M., Carreras I., Sipe J.D.Biochem. J. 283:673-678(1992)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.6 kDa
NCBI Official Full Name
serum amyloid A-2 protein
NCBI Official Synonym Full Names
serum amyloid A 2
NCBI Official Symbol
Saa2
NCBI Official Synonym Symbols
Saa1; Saa-2; AW111173
NCBI Protein Information
serum amyloid A-2 protein
UniProt Protein Name
Serum amyloid A-2 protein
UniProt Gene Name
Saa2
UniProt Entry Name
SAA2_MOUSE

Similar Products

Product Notes

The Saa2 saa2 (Catalog #AAA18466) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-122aa; Full Length of Mature Protein. The amino acid sequence is listed below: GFFSFIGEAF QGAGDMWRAY TDMKEAGWKD GDKYFHARGN YDAAQRGPGG VWAAEKISDA RESFQEFFGR GHEDTMADQE ANRHGRSGKD PNYYRPPGLP AKY . It is sometimes possible for the material contained within the vial of "Serum amyloid A-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.