Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Serum amyloid A-2 Recombinant Protein | SAA2 recombinant protein

Recombinant mouse Serum amyloid A-2 protein

Average rating 0.0
No ratings yet
Gene Names
Saa2; Saa1; Saa-2; AW111173
Reactivity
Mouse
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Serum amyloid A-2; N/A; Recombinant mouse Serum amyloid A-2 protein; Amyloid fibril protein AA; SAA2 recombinant protein
Ordering
Host
E Coli
Reactivity
Mouse
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Full Length, 20-122aa
Sequence
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY
Calculated MW
15.7 kD
Tag Info
His-tag
Preparation and Storage
Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for SAA2 recombinant protein
Recombinant Protein

Major acute phase reactant. Apolipoprotein of the HDL complex.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serum amyloid A-2 protein
NCBI Official Synonym Full Names
serum amyloid A 2
NCBI Official Symbol
Saa2
NCBI Official Synonym Symbols
Saa1; Saa-2; AW111173
NCBI Protein Information
serum amyloid A-2 protein
UniProt Protein Name
Serum amyloid A-2 protein
UniProt Gene Name
Saa2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SAA2 saa2 (Catalog #AAA309743) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 20-122aa. The Recombinant mouse Serum amyloid A-2 protein reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: GFFSFIGEAF QGAGDMWRAY TDMKEAGWKD GDKYFHARGN YDAAQRGPGG VWAAEKISDA RESFQEFFGR GHEDTMADQE ANRHGRSGKD PNYYRPPGLP AKY. It is sometimes possible for the material contained within the vial of "Serum amyloid A-2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.