SDS-PAGE
Sal-like protein 4 (SALL4) Recombinant Protein | SALL4 recombinant protein
Recombinant Human Sal-like protein 4 (SALL4) Protein
Gene Names
SALL4; DRRS; HSAL4; ZNF797
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
Sal-like protein 4 (SALL4); N/A; Recombinant Human Sal-like protein 4 (SALL4) Protein; SALL4; DRRS; HSAL4; ZNF797; dJ1112F19.1; SALL4 recombinant protein
Host
E Coli
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
Lyophilized powder; PBS, pH7.4, containing 0.01 % SKL, 5% Trehalose and 0.02% Proclin 300.
Sequence
KNPPVPSEDFSGAVLSHQPTSPGSKDCHRENGGSSEDMKEKPDAESWYLKTETALPPTPQDISYLAKGKVANTNVTLQALRGTKVAVNQRSADALPAPVPGANSIPVWLEQILCLQQQQLQQIQLTEQIRIQVNMWASHALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAGSQGLSLDALKQ AKLPHANIPSATSSLSPGLAPFTLKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFSTVALDTSKKG
Sequence Length
1053
Source
Human
Protein Residues
N-terminal His-tagged
Usage
SALL4 Protein - MBS recommends that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1 mg/mL. MBS recommends to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store it under sterile conditions at -20·C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.
SDS-PAGE
SDS-PAGE
Related Product Information for SALL4 recombinant protein
SALL4 gene encodes a protein with 3 C2H2 double zinc finger domains of the SAL-type, the second of which has a single C2H2 zinc finger attached at its C-terminal end, as well as an N-terminal C2HC zinc finger motif typical for vertebrate SAL-like proteins. By Northern blot analysis, they detected expression of a 5.5-kb SALL4 transcript exclusively in adult testis. RT-PCR confirmed expression in adult testis and revealed faint SALL4 expression in ovary and spleen. Northern blot analysis of adult mouse tissues detected a 5.0- to 5.5-kb transcript only in testis and ovary. In situ hybridization revealed widespread Sall4 expression in early mouse embryos. Expression was gradually confined to the head region and the primitive streak, and later there was prominent expression in the developing midbrain, branchial arches, limbs, and genital papilla.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted MW: 31.5 kDa
Observed MW: 35 kDa
Observed MW: 35 kDa
NCBI Official Full Name
sal-like protein 4 isoform 1
NCBI Official Synonym Full Names
spalt like transcription factor 4
NCBI Official Symbol
SALL4
NCBI Official Synonym Symbols
DRRS; HSAL4; ZNF797
NCBI Protein Information
sal-like protein 4
UniProt Protein Name
Sal-like protein 4
UniProt Gene Name
SALL4
UniProt Synonym Gene Names
ZNF797
Similar Products
Product Notes
The SALL4 sall4 (Catalog #AAA55982) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: KNPPVPSEDF SGAVLSHQPT SPGSKDCHRE NGGSSEDMKE KPDAESWYLK TETALPPTPQ DISYLAKGKV ANTNVTLQAL RGTKVAVNQR SADALPAPVP GANSIPVWLE QILCLQQQQL QQIQLTEQIR IQVNMWASHA LHSSGAGADT LKTLGSHMSQ QVSAAVALLS QKAGSQGLSL DALKQ AKLPHANIPS ATSSLSPGLA PFTLKPDGTR VLPNVMSRLP SALLPQAPGS VLFQSPFSTV ALDTSKKG. It is sometimes possible for the material contained within the vial of "Sal-like protein 4 (SALL4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.