Histone deacetylase complex subunit SAP130 (Sap130) Recombinant Protein | Sap130 recombinant protein

Recombinant Mouse Histone deacetylase complex subunit SAP130 (Sap130), partial

Cat. Num. AAA18748

• Gene Names: Sap130; 6720406D06; 2610304F09Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Histone deacetylase complex subunit SAP130 (Sap130); N/A; Recombinant Mouse Histone deacetylase complex subunit SAP130 (Sap130), partial; 130 kDa Sin3-associated polypeptide; Sin3-associated polypeptide p130; Sap130 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 845-1057aa; Partial
• Sequence: PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Sap130 recombinant protein

Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes

References

"The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y. Science 309:1559-1563(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 27881435
• NCBI GeneID: 269003
• NCBI Accession #: NP_766553.1
• NCBI GenBank Nucleotide #: NM_172965.2
• UniProt Accession #: Q8BIH0; Q6NZP5; Q6P553; Q8BID9; Q9CSU1
• Molecular Weight: 26.8 kDa
• NCBI Official Full Name: histone deacetylase complex subunit SAP130
• NCBI Official Synonym Full Names: Sin3A associated protein
• NCBI Official Symbol: Sap130
• NCBI Official Synonym Symbols: 6720406D06; 2610304F09Rik
• NCBI Protein Information: histone deacetylase complex subunit SAP130
• UniProt Protein Name: Histone deacetylase complex subunit SAP130
• UniProt Gene Name: Sap130
• UniProt Entry Name: SP130_MOUSE