Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18748_SDS_PAGE.jpg SDS-PAGE

Histone deacetylase complex subunit SAP130 (Sap130) Recombinant Protein | Sap130 recombinant protein

Recombinant Mouse Histone deacetylase complex subunit SAP130 (Sap130), partial

Gene Names
Sap130; 6720406D06; 2610304F09Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone deacetylase complex subunit SAP130 (Sap130); N/A; Recombinant Mouse Histone deacetylase complex subunit SAP130 (Sap130), partial; 130 kDa Sin3-associated polypeptide; Sin3-associated polypeptide p130; Sap130 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
845-1057aa; Partial
Sequence
PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18748_SDS_PAGE.jpg SDS-PAGE
Related Product Information for Sap130 recombinant protein
Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes
References
"The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y. Science 309:1559-1563(2005)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.8 kDa
NCBI Official Full Name
histone deacetylase complex subunit SAP130
NCBI Official Synonym Full Names
Sin3A associated protein
NCBI Official Symbol
Sap130
NCBI Official Synonym Symbols
6720406D06; 2610304F09Rik
NCBI Protein Information
histone deacetylase complex subunit SAP130
UniProt Protein Name
Histone deacetylase complex subunit SAP130
UniProt Gene Name
Sap130
UniProt Entry Name
SP130_MOUSE

Similar Products

Product Notes

The Sap130 sap130 (Catalog #AAA18748) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 845-1057aa; Partial. The amino acid sequence is listed below: PRKQQHVIST EEGDMMETNS TDDEKSAAKS LLVKAEKRKS PPKEYIDEEG VRYVPVRPRP PITLLRHYRN PWKAAYHHFQ RYSDVRVKEE KKAMLQEIAN QKGVSCRAQG WKVHLCAAQL LQLTNLEHDV YERLTNLQEG IIPKKKAATD DDLHRINELI QGNMQRCKLV MDQISEARDS MLKVLDHKDR VLKLLNKNGT VKKVSKLKRK EKV . It is sometimes possible for the material contained within the vial of "Histone deacetylase complex subunit SAP130 (Sap130), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.