Schistosoma japonicum SJCHGC06900 Recombinant Protein
Recombinant Schistosoma japonicum SJCHGC06900 protein
Applications
ELISA, SDS-Page
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Schistosoma japonicum SJCHGC06900; N/A; Recombinant Schistosoma japonicum SJCHGC06900 protein; Schistosoma japonicum SJCHGC06900 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
MWVENNDSPCLGSVPVIKGKFKEMPKNAQRFVAKWVEICKPTGVYICDGSKEEKQELTEKLIELGSLHKLPPYENNYITCTDPKDVARVESKTWICSEHKKDTVPDVAPGVHGVLGQWISPDDLNTEIHDRYPNCMEGRVLYVIPFSMGPIGSPLSKVGIELTDSIYVVLCMTIMTRMHPKVWNVIESSKEFVRCVHSVGCPTSSNQIVKNNWPCNPEKTLISHVPKERLIMSFGSGYGGNSLLGKKCFALRIAGCIARDEGWLAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPSVPGWKVQCVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNKKTNPNAMATCMKNTIFTNIGQTKDGHIFWEGLEDQYSPDTEIITWLGDHVKLSDKSKDPKAHPNSRFCCPANQCPIIHPKWEDPQGVPISALIFGGRRPSGIPLVMQSFDWKHGVMLGAALKSEATAAAEFTGKSVMHDPMAMRPFVGYNFGHYLDHWLGMEKPSRKMPLIFHVNWFRLNEHGKFVWPGFGHNIRVIDWILRRVDGEDNGVHSPIGILPKKDSINFDGLNIDWDENFSLPKDYLLEDVDETIKYLHEQVGKDLPVVIQKELINQRERIQSEL-
Applicable Applications for Schistosoma japonicum SJCHGC06900 recombinant protein
ELISA, SDS-PAGE
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Notes? Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
NCBI and Uniprot Product Information
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Schistosoma japonicum SJCHGC06900 (Catalog #AAA113799) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Schistosoma japonicum SJCHGC06900 can be used in a range of immunoassay formats including, but not limited to, ELISA, SDS-PAGE. Researchers should empirically determine the suitability of the Schistosoma japonicum SJCHGC06900 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWVENNDSPC LGSVPVIKGK FKEMPKNAQR FVAKWVEICK PTGVYICDGS KEEKQELTEK LIELGSLHKL PPYENNYITC TDPKDVARVE SKTWICSEHK KDTVPDVAPG VHGVLGQWIS PDDLNTEIHD RYPNCMEGRV LYVIPFSMGP IGSPLSKVGI ELTDSIYVVL CMTIMTRMHP KVWNVIESSK EFVRCVHSVG CPTSSNQIVK NNWPCNPEKT LISHVPKERL IMSFGSGYGG NSLLGKKCFA LRIAGCIARD EGWLAEHMLI MSVTNPKGEE KFIAAAFPSA CGKTNMAMLE PSVPGWKVQC VGDDIAWMRF DEHGVLRAIN PEAGFFGVAP GTNKKTNPNA MATCMKNTIF TNIGQTKDGH IFWEGLEDQY SPDTEIITWL GDHVKLSDKS KDPKAHPNSR FCCPANQCPI IHPKWEDPQG VPISALIFGG RRPSGIPLVM QSFDWKHGVM LGAALKSEAT AAAEFTGKSV MHDPMAMRPF VGYNFGHYLD HWLGMEKPSR KMPLIFHVNW FRLNEHGKFV WPGFGHNIRV IDWILRRVDG EDNGVHSPIG ILPKKDSINF DGLNIDWDEN FSLPKDYLLE DVDETIKYLH EQVGKDLPVV IQKELINQRE RIQSEL-. It is sometimes possible for the material contained within the vial of "Schistosoma japonicum SJCHGC06900, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
