Selenoprotein P (SEPP1) Recombinant Protein | SEPP1 recombinant protein

Recombinant Human Selenoprotein P (SEPP1) (U59S, U300S, U318S, U330S, U345S, U352S, U367S, U369S, U376S, U378S)

Cat. Num. AAA18590

• Gene Names: SEPP1; SeP; SELP; SEPP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Selenoprotein P (SEPP1); N/A; Recombinant Human Selenoprotein P (SEPP1) (U59S, U300S, U318S, U330S, U345S, U352S, U367S, U369S, U376S, U378S); SEPP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-381aa (U59S, U300S, U318S, U330S, U345S, U352S, U367S, U369S, U376S, U378S); Full Length of Mature Protein
• Sequence: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Sequence Information

(There are 10 selenocysteine (U) in the original sequence. The amino acids at multiple sites are ‘U’ in UniProt (yellow highlighted; U59S, U300S, U318S, U330S, U345S, U352S, U367S, U369S, U376S, U378S), reference:: https://www.uniprot.org/uniprot/P49908 ). The ‘U’ at each yellow highlighted site has been mutated to ‘S’ to manufacture the AAA18590 Recombinant Human Selenoprotein P. 'U' selenocysteine is encoded by UGA and it is normally used as a stop codon in prokaryotic cells, which will lead to early termination of translation, hence the lab mutates this selenocysteine for protein manufacturing. In terms of the formation of selenocysteine, selenocysteine is actually a derivative of serine. Selenocysteine and cysteine as well as serine are all highly similar. This selenocysteine can be regarded as either the 'S' of cysteine replaced by Se, or the 'O' of serine replaced by Se. The selenocysteine can mutated to be either serine or cysteine.Generally, the lab mutates 'U' to serine for protein expression because mutating the 'U' to cysteine may result in the formation of additional disulfide bonds, potentially affecting the expression and structure of the protein.)

Related Product Information for SEPP1 recombinant protein

Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.

References

Conserved nucleotide sequences in the open reading frame and 3' untranslated region of selenoprotein P mRNA.Hill K.E., Lloyd R.S., Burk R.F.Proc. Natl. Acad. Sci. U.S.A. 90:537-541(1993) Hill K.E.NIEHS SNPs programThe DNA sequence and comparative analysis of human chromosome 5.Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S., Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.Nature 431:268-274(2004) Purification of selenoprotein P from human plasma.Aakesson B., Bellew T., Burk R.F.Biochim. Biophys. Acta 1204:243-249(1994) A novel method for the purification of selenoprotein P from human plasma.Mostert V., Lombeck I., Abel J.Arch. Biochem. Biophys. 357:326-330(1998) Selenoprotein P properties, functions, and regulation.Mostert V.Arch. Biochem. Biophys. 376:433-438(2000) Selenoprotein P. A selenium-rich extracellular glycoprotein.Burk R.F., Hill K.E.J. Nutr. 124:1891-1897(1994) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) A strategy for precise and large scale identification of core fucosylated glycoproteins.Jia W., Lu Z., Fu Y., Wang H.P., Wang L.H., Chi H., Yuan Z.F., Zheng Z.B., Song L.N., Han H.H., Liang Y.M., Wang J.L., Cai Y., Zhang Y.K., Deng Y.L., Ying W.T., He S.M., Qian X.H.Mol. Cell. Proteomics 8:913-923(2009) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

• NCBI GI #: 148277018
• NCBI GeneID: 6414
• NCBI Accession #: NP_001078955.1
• NCBI GenBank Nucleotide #: NM_001085486.1
• UniProt Accession #: P49908; Q6PD59; Q6PI43; Q6PI87; Q6PJF9
• Molecular Weight: 42.6 kDa
• NCBI Official Full Name: selenoprotein P isoform 1
• NCBI Official Synonym Full Names: selenoprotein P, plasma, 1
• NCBI Official Symbol: SEPP1
• NCBI Official Synonym Symbols: SeP; SELP; SEPP
• NCBI Protein Information: selenoprotein P
• UniProt Protein Name: Selenoprotein P
• UniProt Gene Name: SEPP1
• UniProt Synonym Gene Names: SELP; SeP
• UniProt Entry Name: SEPP1_HUMAN