Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Vascular Endothelial Growth Factor Active Protein | rVEGFC active protein

Recombinant Rat Vascular Endothelial Growth Factor Related Protein

Average rating 0.0
No ratings yet
Gene Names
Vegfa; VPF; Vegf; VEGF-A; VEGF164
Purity
Greater than 90.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Vascular Endothelial Growth Factor; N/A; Recombinant Rat Vascular Endothelial Growth Factor Related Protein; VEGF C Rat; Vascular Endothelial Growth Factor Related Protein Rat Recombinant; VEGF-C; Vascular endothelial growth factor C; VRP; Flt4 ligand; Flt4-L; rVEGFC active protein
Ordering
Host
Sf9 Insect Cells
Purity/Purification
Greater than 90.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
Each mg of VEGF-C Rat contains 50mg BSA and PBS as buffer.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH
Sequence Length
325
Solubility
It is recommended to reconstitute the lyophilized Vascular Endothelial Growth Factor C in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg.
Preparation and Storage
Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution VEGF-C should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.Please prevent freeze-thaw cycles.
Related Product Information for rVEGFC active protein
Description: Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.

Introduction: VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The rat VEGFC cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant rat VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT -4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant rat VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A.
Product Categories/Family for rVEGFC active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,189 Da
NCBI Official Full Name
vascular endothelial growth factor A isoform 3
NCBI Official Synonym Full Names
vascular endothelial growth factor A
NCBI Official Symbol
Vegfa
NCBI Official Synonym Symbols
VPF; Vegf; VEGF-A; VEGF164
NCBI Protein Information
vascular endothelial growth factor A; vascular permeability factor
UniProt Protein Name
Vascular endothelial growth factor A
UniProt Gene Name
Vegfa
UniProt Synonym Gene Names
Vegf; VEGF-A; VPF
UniProt Entry Name
VEGFA_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The rVEGFC vegfa (Catalog #AAA38139) is an Active Protein produced from Sf9 Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DTVKLAAAHY NTEILKSIDN EWRKTQCMPR EVCIDVGKEF GAATNTFFKP PCVSVYRCGG CCNSEGLQCM NTSTGYLSKT LFEITVPLSQ GPKPVTISFA NHTSCRCMSK LDVYRQVHSI IHHHHHH . It is sometimes possible for the material contained within the vial of "Vascular Endothelial Growth Factor, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.