Surfactant Protein B Recombinant Protein | SFTPB recombinant protein
Recombinant Human Surfactant Protein B
Gene Names
SFTPB; SP-B; PSP-B; SFTB3; SFTP3; SMDP1
Purity
>95.0% as determined by SDS-PAGE
Synonyms
Surfactant Protein B; N/A; Recombinant Human Surfactant Protein B; Surfactant Protein B Human Recombinant; Pulmonary surfactant-associated protein B; SP-B; 18 kDa pulmonary-surfactant protein; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL(Phe); SFTPB; SFTP3; SFTPB Human; SFTPB recombinant protein
Host
HEK293 Cells
Purity/Purification
>95.0% as determined by SDS-PAGE
Form/Format
SFPTB Filtered (0.4 um) and lyophilized from 0.5mg/ml solution in PBS and 5% trehalose (w/v), pH 7.4.
Sequence
WTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLE QECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPL LDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCL AERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQA CVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDLHHHHHH
Sequence Length
393
Solubility
It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/ml and let the lyophilized pellet dissolve completely.
Physical Appearance
Filtered White Lyophilized (Freeze-Dried) Powder
Preparation and Storage
Store lyophilized protein at -20 degree C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Reconstituted protein can be stored at 4 degree C for a limited period of time; it does not show any change after two weeks at 4 degree C.
Reconstituted protein can be stored at 4 degree C for a limited period of time; it does not show any change after two weeks at 4 degree C.
Related Product Information for SFTPB recombinant protein
Introduction: SFTPB is an amphipathic surfactant protein critical for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which consist of plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. Pulmonary surfactant-associated proteins support alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. The SPB improves the rate of spreading and increases the stability of surfactant monolayers in vitro. SPB increases the collapse pressure of palmitic acid to approximately 70 millinewtons per meter.
Description: SFTPB Human Recombinant is a single, glycosylated polypeptide chain containing 363 amino acids (25-381a.a) and having a molecular mass of 40.4kDa (calculated). SFPTB is fused to a 6 a.a on C-terminal.
Description: SFTPB Human Recombinant is a single, glycosylated polypeptide chain containing 363 amino acids (25-381a.a) and having a molecular mass of 40.4kDa (calculated). SFPTB is fused to a 6 a.a on C-terminal.
Product Categories/Family for SFTPB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
pulmonary surfactant-associated protein B
NCBI Official Synonym Full Names
surfactant protein B
NCBI Official Symbol
SFTPB
NCBI Official Synonym Symbols
SP-B; PSP-B; SFTB3; SFTP3; SMDP1
NCBI Protein Information
pulmonary surfactant-associated protein B
UniProt Protein Name
Pulmonary surfactant-associated protein B
UniProt Gene Name
SFTPB
UniProt Synonym Gene Names
SFTP3; SP-B
UniProt Entry Name
PSPB_HUMAN
Similar Products
Product Notes
The SFTPB sftpb (Catalog #AAA38058) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: WTTSSLACAQ GPEFWCQSLE QALQCRALGH CLQEVWGHVG ADDLCQECED IVHILNKMAK EAIFQDTMRK FLE QECNVLPLKL LMPQCNQVLD DYFPLVIDYF QNQTDSNGIC MHLGLCKSRQ PEPEQEPGMS DPLPKPLRDP LPDPL LDKLVLPVLP GALQARPGPH TQDLSEQQFP IPLPYCWLCR ALIKRIQAMI PKGALAVAVA QVCRVVPLVA GGICQCL AERYSVILLD TLLGRMLPQL VCRLVLRCSM DDSAGPRSPT GEWLPRDSEC HLCMSVTTQA GNSSEQAIPQ AMLQA CVGSWLDREK CKQFVEQHTP QLLTLVPRGW DAHTTCQALG VCGTMSSPLQ CIHSPDLHHH HHH. It is sometimes possible for the material contained within the vial of "Surfactant Protein B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.