Sucrose synthase 1 Recombinant Protein | SH-1 recombinant protein

Recombinant Zea mays (Maize) Sucrose synthase 1

Cat. Num. AAA114375

• Gene Names: SH-1; GRMZM2G089713
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Sucrose synthase 1; N/A; Recombinant Zea mays (Maize) Sucrose synthase 1; Shrunken-1; Sucrose-UDP glucosyltransferase 1; SH-1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 555-802aa; Partial
• Sequence: NSEHKFVLKDKKKPIIFSMARLDRVKNMTGLVEMYGKNARLRELANLVIVAGDHGKESKDREEQAEFKKMYSLIDEYKLKGHIRWISAQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVIESMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFDKCKADPSYWDEISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYALKYRSLASQVPLSFD
• Sequence Length: 802

• Species: Zea mays (Maize)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SH-1 recombinant protein

Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways. Most active in the sink tissues where it is responsible for the breakdown of the arriving sucrose.

References

"Structure of the sucrose synthase gene on chromosome 9 of Zea mays L." Werr W., Frommer W.-B., Maas C., Starlinger P. EMBO J. 4:1373-1380(1985)

NCBI and Uniprot Product Information

• NCBI GI #: 162460741
• NCBI GeneID: 542365
• NCBI Accession #: NP_001105411.1
• NCBI GenBank Nucleotide #: NM_001111941.1
• UniProt Accession #: P04712
• Molecular Weight: 44.8 kDa
• NCBI Official Full Name: sucrose synthase 1
• NCBI Official Symbol: SH-1
• NCBI Official Synonym Symbols: GRMZM2G089713
• NCBI Protein Information: sucrose synthase 1
• UniProt Protein Name: Sucrose synthase 1
• UniProt Gene Name: SH-1
• UniProt Entry Name: SUS1_MAIZE