Sex hormone-binding globulin Recombinant Protein | SHBG recombinant protein

Recombinant Human Sex hormone-binding globulin

Cat. Num. AAA113978

• Gene Names: SHBG; ABP; SBP; TEBG
• Applications: Calibrator
• Purity: 85% ± 5% by SDS-PAGE
• Synonyms: Sex hormone-binding globulin; N/A; Recombinant Human Sex hormone-binding globulin; Sex steroid-binding protein; SBP; Testis-specific androgen-binding protein; ABP; Testosterone-estradiol-binding globulin; TeBG; Testosterone-estrogen-binding globulin; SHBG recombinant protein

• Host: E. coli
• Purity/Purification: 85% ± 5% by SDS-PAGE
• Form/Format: Liquid, dissolved in 20mM Tris-HCl, 500mM NaCl, pH 8.0, 50% glycerol
• Sequence Positions: 30-402
• Sequence: LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH

• Applicable Applications for SHBG recombinant protein: Calibrator
• Tag Info: his-tag
• Valid Period: -20 degree C for one year
• Product Note: Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
• Preparation and Storage: Aliquot and store at < -20°C. Avoid repeated freeze / thaw cycles

Product Categories/Family for SHBG recombinant protein

Signal Transduction; Raw Materials Assay Development

References

Characterization of the human sex hormone binding globulin (SHBG) gene and demonstration of two transcripts in both liver and testis.Gershagen S., Lundwall A., Fernlund P.Nucleic Acids Res. 17:9245-9258(1989) The human sex hormone-binding globulin gene contains exons for androgen-binding protein and two other testicular messenger RNAs.Hammond G.L., Underhill D.A., Rykse H.M., Smith C.L.Mol. Endocrinol. 3:1869-1876(1989) PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.Jin P., Fu G.K., Wilson A.D., Yang J., Chien D., Hawkins P.R., Au-Young J., Stuve L.L.Genomics 83:566-571(2004) DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006) The cDNA-deduced primary structure of human sex hormone-binding globulin and location of its steroid-binding domain.Hammond G.L., Underhill D.A., Smith C.L., Goping I.S., Harley M.J., Musto N.A., Cheng C.Y., Bardin C.W.FEBS Lett. 215:100-104(1987) Human sex hormone-binding globulin gene transcript expression in liver, prostate, breast, testis, and brain- multiple promoters and complex alternative splicing.Kahn S.M., Nakhla A.M., Hryb D.J., Rosner W., Romas N.A. A cDNA coding for human sex hormone binding globulin. Homology to vitamin K-dependent protein S.Gershagen S., Fernlund P., Lundwall A.FEBS Lett. 220:129-135(1987) Characterization of a cDNA coding for sex steroid-binding protein of human plasma.Que B.G., Petra P.H.FEBS Lett. 219:405-409(1987) Physicochemical characteristics of human sex hormone binding globulin evidence for two identical subunits.Hammond G.L., Robinson P.A., Sugino H., Ward D.N., Finne J.J. Steroid Biochem. 24:815-824(1986) Amino acid sequence of the sex steroid binding protein of human blood plasma.Walsh K.A., Titani K., Takio K., Kumar S., Hayes R., Petra P.H.Biochemistry 25:7584-7590(1986) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Molecular analyses of a human sex hormone-binding globulin variant evidence for an additional carbohydrate chain.Power S.G.A., Bocchinfuso W.P., Pallesen M., Warmels-Rodenhiser S., Van Baelen H., Hammond G.L.J. Clin. Endocrinol. Metab. 75:1066-1070(1992) Crystal structure of human sex hormone-binding globulin steroid transport by a laminin G-like domain.Grishkovskaya I., Avvakumov G.V., Sklenar G., Dales D., Hammond G.L., Muller Y.A.EMBO J. 19:504-512(2000) Steroid ligands bind human sex hormone-binding globulin in specific orientations and produce distinct changes in protein conformation.Grishkovskaya I., Avvakumov G.V., Hammond G.L., Catalano M.G., Muller Y.A.J. Biol. Chem. 277:32086-32093(2002) Molecular characterization of a genetic variant of the steroid hormone-binding globulin gene in heterozygous subjects.Hardy D.O., Carino C., Catterall J.F., Larrea F.J. Clin. Endocrinol. Metab. 80:1253-1256(1995) Characterization of single-nucleotide polymorphisms in coding regions of human genes.Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 22:231-238(1999) ErratumCargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 23:373-373(1999)

NCBI and Uniprot Product Information

• NCBI GI #: 7382460
• NCBI GeneID: 6462
• NCBI Accession #: NP_001031.2
• NCBI GenBank Nucleotide #: NM_001040.4
• UniProt Accession #: P04278; P14689; Q16616; Q3MIL0; Q6ISD2; B0FWH4; E9PGW1; F5H5Z8; I3L1N7
• NCBI Official Full Name: sex hormone-binding globulin isoform 1
• NCBI Official Synonym Full Names: sex hormone-binding globulin
• NCBI Official Symbol: SHBG
• NCBI Official Synonym Symbols: ABP; SBP; TEBG
• NCBI Protein Information: sex hormone-binding globulin
• UniProt Protein Name: Sex hormone-binding globulin
• UniProt Gene Name: SHBG
• UniProt Synonym Gene Names: SHBG; SBP; ABP; TeBG
• UniProt Entry Name: SHBG_HUMAN