Excitatory amino acid transporter 2 Recombinant Protein | EAA2 recombinant protein
Recombinant mouse Excitatory amino acid transporter 2
Gene Names
Slc1a2; GLT1; Eaat2; GLT-1; MGLT1; AI159670; 1700091C19Rik; 2900019G14Rik
Reactivity
Mouse
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Excitatory amino acid transporter 2; N/A; Recombinant mouse Excitatory amino acid transporter 2; GLT-1Sodium-dependent glutamate/aspartate transporter 2Solute carrier family 1 member 2; EAA2 recombinant protein
Host
E Coli
Reactivity
Mouse
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Extracellular Domain, 143-238
Sequence
HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG
Sequence Length
238
Product type
Recombinant Protein
Target Name
EAA2
Tag Info
GST-tag
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for EAA2 recombinant protein
Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly roving released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38kD
NCBI Official Full Name
excitatory amino acid transporter 2 isoform 1
NCBI Official Synonym Full Names
solute carrier family 1 (glial high affinity glutamate transporter), member 2
NCBI Official Symbol
Slc1a2
NCBI Official Synonym Symbols
GLT1; Eaat2; GLT-1; MGLT1; AI159670; 1700091C19Rik; 2900019G14Rik
NCBI Protein Information
excitatory amino acid transporter 2
UniProt Protein Name
Excitatory amino acid transporter 2
UniProt Gene Name
Slc1a2
UniProt Synonym Gene Names
Eaat2; Glt1
Similar Products
Product Notes
The EAA2 slc1a2 (Catalog #AAA309745) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Extracellular Domain, 143-238. The Recombinant mouse Excitatory amino acid transporter 2 reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: HPGNPKLKKQ LGPGKKNDEV SSLDAFLDLI RNLFPENLVQ ACFQQIQTVT KKVLVAPPSE EANTTKAVIS MLNETMNEAP EETKIVIKKG LEFKDG. It is sometimes possible for the material contained within the vial of "Excitatory amino acid transporter 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.