Secreted Ly-6/uPAR-related protein 1 Recombinant Protein | SLURP1 recombinant protein
Recombinant Human Secreted Ly-6/uPAR-related protein 1
Gene Names
SLURP1; ARS; MDM; ANUP; ArsB; LY6LS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Secreted Ly-6/uPAR-related protein 1; N/A; Recombinant Human Secreted Ly-6/uPAR-related protein 1; ARS component B; ARS(component B)-81/S; Anti-neoplastic urinary protein; ANUP; SLURP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-103aa; Full Length of Mature Protein
Sequence
LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for SLURP1 recombinant protein
Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.
Product Categories/Family for SLURP1 recombinant protein
References
"Biological effects of SLURP-1 on human keratinocytes." Arredondo J., Chernyavsky A.I., Webber R.J., Grando S.A. J. Invest. Dermatol. 125:1236-1241(2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10.9 kDa
NCBI Official Full Name
secreted Ly-6/uPAR-related protein 1
NCBI Official Synonym Full Names
secreted LY6/PLAUR domain containing 1
NCBI Official Symbol
SLURP1
NCBI Official Synonym Symbols
ARS; MDM; ANUP; ArsB; LY6LS
NCBI Protein Information
secreted Ly-6/uPAR-related protein 1
UniProt Protein Name
Secreted Ly-6/uPAR-related protein 1
UniProt Gene Name
SLURP1
UniProt Synonym Gene Names
ARS; SLURP-1; ANUP
UniProt Entry Name
SLUR1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The SLURP1 slurp1 (Catalog #AAA113129) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-103aa; Full Length of Mature Protein. The amino acid sequence is listed below: LKCYTCKEPM TSASCRTITR CKPEDTACMT TLVTVEAEYP FNQSPVVTRS CSSSCVATDP DSIGAAHLIF CCFRDLCNSE L. It is sometimes possible for the material contained within the vial of "Secreted Ly-6/uPAR-related protein 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
