Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Sorting nexin-16 (SNX16) Recombinant Protein | SNX16 recombinant protein

Recombinant Human Sorting nexin-16 (SNX16)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sorting nexin-16 (SNX16); N/A; Recombinant Human Sorting nexin-16 (SNX16); SNX16 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-344aa; Full Length
Sequence
MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSSPLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SNX16 recombinant protein
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. The function of this protein has not been determined. This gene results in three transcript variants encoding two distinct isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,566 Da
NCBI Official Full Name
sorting nexin-16 isoform a
NCBI Official Synonym Full Names
sorting nexin 16
NCBI Official Symbol
SNX16
NCBI Protein Information
sorting nexin-16
UniProt Protein Name
Sorting nexin-16
UniProt Gene Name
SNX16

Similar Products

Product Notes

The SNX16 snx16 (Catalog #AAA81677) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-344aa; Full Length. The amino acid sequence is listed below: MATPYVPVPM PIGNSASSFT TNRNQRSSSF GSVSTSSNSS KGQLEDSNMG NFKQTSVPDQ MDNTSSVCSS PLIRTKFTGT ASSIEYSTRP RDTEEQNPET VNWEDRPSTP TILGYEVMEE RAKFTVYKIL VKKTPEESWV VFRRYTDFSR LNDKLKEMFP GFRLALPPKR WFKDNYNADF LEDRQLGLQA FLQNLVAHKD IANCLAVREF LCLDDPPGPF DSLEESRAFC ETLEETNYRL QKELLEKQKE MESLKKLLSE KQLHIDTLEN RIRTLSLEPE ESLDVSETEG EQILKVESSA LEVDQDVLDE ESRADNKPCL SFSEPENAVS EIEVAEVAYD AEED. It is sometimes possible for the material contained within the vial of "Sorting nexin-16 (SNX16), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.