Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA115473_SDS_PAGE15.jpg SDS-PAGE

Suppressor of cytokine signaling 3 Recombinant Protein | Socs3 recombinant protein

Recombinant Rat Suppressor of cytokine signaling 3

Average rating 0.0
No ratings yet
Gene Names
Socs3; Cish3; Ssi-3; Socs-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Suppressor of cytokine signaling 3; N/A; Recombinant Rat Suppressor of cytokine signaling 3; Cytokine-inducible SH2 protein 3; Socs3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-225. Full-length.
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV LKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Sequence Length
225
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA115473_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Socs3 recombinant protein
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Ses to recognize IL6ST.
References
Endotoxin-induced inhibition of growth hormone receptor signaling in rat liver in vivo.Mao Y., Ling P.R., Fitzgibbons T.P., McCowen K.C., Frick G.P., Bistrian B.R., Smith R.J.Endocrinology 140:5505-5515(1999) le Cam A. Identification of the Y985 and Y1077 motifs as SOCS3 recruitment sites in the murine leptin receptor.Eyckerman S., Broekaert D., Verhee A., Vandekerckhove J., Tavernier J.FEBS Lett. 486:33-37(2000)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.8 kDa
NCBI Official Full Name
suppressor of cytokine signaling 3
NCBI Official Synonym Full Names
suppressor of cytokine signaling 3
NCBI Official Symbol
Socs3
NCBI Official Synonym Symbols
Cish3; Ssi-3; Socs-3
NCBI Protein Information
suppressor of cytokine signaling 3
UniProt Protein Name
Suppressor of cytokine signaling 3
UniProt Gene Name
Socs3
UniProt Synonym Gene Names
Cish3; SOCS-3
UniProt Entry Name
SOCS3_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Socs3 socs3 (Catalog #AAA115473) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-225. Full-length. The amino acid sequence is listed below: MVTHSKFPAA GMSRPLDTSL RLKTFSSKSE YQLVVNAVRK LQESGFYWSA VTGGEANLLL SAEPAGTFLI RDSSDQRHFF TLSVETQSGT KNLRIQCEGG SFSLQSDPRS TQPVPRFDCV LKLVHHYMP PPGAPSFSLP PTEPSFEVQE QPPAQALPGG TPKRAYYIYS GGEKIPLVLS RPLSSNVATL QHLCRKTVNG HLDSYEKVTQ LPGPIREFLD QYDAPL. It is sometimes possible for the material contained within the vial of "Suppressor of cytokine signaling 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.