Superoxide dismutase [Cu-Zn] Recombinant Protein | Sod1 recombinant protein
Recombinant Mouse Superoxide dismutase [Cu-Zn]
Gene Names
Sod1; Ipo1; SODC; Ipo-1; Sod-1; CuZnSOD; Cu/Zn-SOD; B430204E11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Superoxide dismutase [Cu-Zn]; N/A; Recombinant Mouse Superoxide dismutase [Cu-Zn]; Sod1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-154aa; Full Length
Sequence
AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Sequence Length
154
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Sod1 recombinant protein
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
References
cDNA and deduced amino acid sequence of murine Cu-Zn superoxide dismutase.Bewley G.C.Nucleic Acids Res. 16:2728-2728(1988) Isolation and analysis of the mouse genomic sequence encoding Cu(2+) -Zn2+ superoxide dismutase.Benedetto M.T., Anzai Y., Gordon J.W.Gene 99:191-195(1991) Purification of an inhibitor of erythroid progenitor cell cycling and antagonist to interleukin 3 from mouse marrow cell supernatants and its identification as cytosolic superoxide dismutase.Pluthero F.G., Shreeve M., Eskinazi D., van der Gaag H., Huang K.S., Hulmes J.D., Blum M., Axelrad A.A.J. Cell Biol. 111:1217-1223(1990) Lubec G., Klug S., Sunyer B., Chen W.-Q.Submitted (JAN-2009) to UniProtKB Knockout of SOD1 promotes conversion of selenocysteine to dehydroalanine in murine hepatic GPX1 protein.Wang S.K., Weaver J.D., Zhang S., Lei X.G.Free Radic. Biol. Med. 51:197-204(2011) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013) Label-free quantitative proteomics of the lysine acetylome in mitochondria identifies substrates of SIRT3 in metabolic pathways.Rardin M.J., Newman J.C., Held J.M., Cusack M.P., Sorensen D.J., Li B., Schilling B., Mooney S.D., Kahn C.R., Verdin E., Gibson B.W.Proc. Natl. Acad. Sci. U.S.A. 110:6601-6606(2013) Structures of mouse SOD1 and human/mouse SOD1 chimeras.Seetharaman S.V., Taylor A.B., Holloway S., Hart P.J.Arch. Biochem. Biophys. 503:183-190(2010)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.8 kDa
NCBI Official Full Name
superoxide dismutase
NCBI Official Synonym Full Names
superoxide dismutase 1, soluble
NCBI Official Symbol
Sod1
NCBI Official Synonym Symbols
Ipo1; SODC; Ipo-1; Sod-1; CuZnSOD; Cu/Zn-SOD; B430204E11Rik
NCBI Protein Information
superoxide dismutase [Cu-Zn]
UniProt Protein Name
Superoxide dismutase [Cu-Zn]
UniProt Gene Name
Sod1
UniProt Entry Name
SODC_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Sod1 sod1 (Catalog #AAA113865) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-154aa; Full Length. The amino acid sequence is listed below: AMKAVCVLKG DGPVQGTIHF EQKASGEPVV LSGQITGLTE GQHGFHVHQY GDNTQGCTSA GPHFNPHSKK HGGPADEERH VGDLGNVTAG KDGVANVSIE DRVISLSGEH SIIGRTMVVH EKQDDLGKGG NEESTKTGNA GSRLACGVIG IAQ. It is sometimes possible for the material contained within the vial of "Superoxide dismutase [Cu-Zn], Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
