Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA59633_AD13.jpg Application Data (Recombinant Sortase (2A.9) protein specificity for LAETG sequence Sortase (2A.9) at 12 ng/ul was incubated with 0.4 mM LAETG, LPETG or LPESG substrates in reaction buffer, followed by fluorescence detection upon cleavage. Results demonstrate the high specificity of Sortase (2A.9) for LAETG. The 2A.9 shows minimal activity to the WT substrate LPETG and no activity towards the mutated substrate LPESG.)

Sortase Recombinant Protein

Recombinant Sortase (2A.9) protein

Synonyms
Sortase; N/A; Recombinant Sortase (2A.9) protein; Sortase recombinant protein
Ordering
Host
E Coli
Form/Format
Sortase 2A.9 protein expressed in E Coli and provided at 1mg/ml in 25mM Tris, pH7.5, 150mM NaCl, 5mM DTT, and 5% Glycerol.
Sequence
MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVCFHDENESLDDQNISIAGHTFIDRPNYQFTNLKAAKPGSMVYFKVGNETRIYKMTSIRKVHPNAVEVLDEQEGKDKQLTLVTCDDYNEETGVWESRKIFVATEVKGSHHHHHH
Protein Species
S. aureus
Tag
His-Tag
Protein Details
Recombinant Sortase 2A.9 protein containing the following amino acid substitutions relative to Sortase A5 pentamutant (S. aureaus, Uniprot A0A077UNB8-1): S102C, A104H, E105D, K138P, K152I, N160K, K162H, T164N, K173E, I182V, T196S. The protein was expressed in E Coli and includes a C-terminal 6xHis-tag. The protein has a calculated molecular weight of 17.8kDa and an observed molecular weight of approximately 20kDa.
Notes
Sortase 2A.9 recognizes an antibody or protein genetically engineered to contain the LAXTG motif, where X is any amino acid. Sortase 2A.9 cleaves this sequence between the threonine and glycine residues and the terminal glycine is then replaced with any poly-Glycine (G)n label to attach HRP, biotin, fluorophores and other labels. Sortase A2.9 may be used in a variety of labeling applications and conditions. Some suggested buffers for use are as follows: Reaction Buffer: 300mM Tris-HCl, 150mM NaCl, 5mM CaCl2, pH 7.5 Stop Solution: 500mM EGTA, pH 8.0.
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Recombinant proteins in solution are temperature sensitive and must be stored at -80 degree C to prevent degradation. Avoid repeated freeze/thaw cycles and keep on ice when not in storage.
Shipping Temp: Dry Ice

Application Data

(Recombinant Sortase (2A.9) protein specificity for LAETG sequence Sortase (2A.9) at 12 ng/ul was incubated with 0.4 mM LAETG, LPETG or LPESG substrates in reaction buffer, followed by fluorescence detection upon cleavage. Results demonstrate the high specificity of Sortase (2A.9) for LAETG. The 2A.9 shows minimal activity to the WT substrate LPETG and no activity towards the mutated substrate LPESG.)

product-image-AAA59633_AD13.jpg Application Data (Recombinant Sortase (2A.9) protein specificity for LAETG sequence Sortase (2A.9) at 12 ng/ul was incubated with 0.4 mM LAETG, LPETG or LPESG substrates in reaction buffer, followed by fluorescence detection upon cleavage. Results demonstrate the high specificity of Sortase (2A.9) for LAETG. The 2A.9 shows minimal activity to the WT substrate LPETG and no activity towards the mutated substrate LPESG.)

SDS-PAGE

(Recombinant Sortase 2A.9 SDS-PAGE gel 1.5 ug of Sortase 2A.9 protein was run on a 4% to 12% gradient gel, followed by staining with Coomassie blue. Calculated MW: 17.8 kDa Observed MW: 20 kDa)

product-image-AAA59633_SDS_PAGE15.jpg SDS-PAGE (Recombinant Sortase 2A.9 SDS-PAGE gel 1.5 ug of Sortase 2A.9 protein was run on a 4% to 12% gradient gel, followed by staining with Coomassie blue. Calculated MW: 17.8 kDa Observed MW: 20 kDa)
Related Product Information for Sortase recombinant protein
Short Description: Sortase 2A.9 is an engineered variant of the wild-type sortase from Staphylococcus aureus that is significantly more active than the wild-type sortase for site-specific labeling of antibodies or proteins containing an LAXTG recognition sequence (where X is any amino acid). Directly conjugate fluorophores, enzymes (HRP, AP), biotin, peptides, DNA, carbohydrates or other labels to the terminal end of the heavy chain to ensure the antigen binding site remains available for target recognition.

Background: Sortase belongs to a class of transpeptidases that utilize an active site cysteine thiol to modify proteins by recognizing and cleaving a carboxy-terminal sorting signal, LPXTG (where X is any amino acid), between the threonine and glycine residues. Sortase 2A.9 is an engineered variant of the wild-type sortase from Staphylococcus aureus that is significantly more active than the wild-type sortase for site-specific labeling of antibodies or proteins containing an LAXTG recognition sequence (where X is any amino acid). Easily attach a wide variety of labels such as peptides, DNA, carbohydrates or fluorophores containing a poly-Glycine sequence (Gly)n (where n = 3 or more Glycine residues). Sortase 2A.9 is covered by US Patent No. 10,202,593.
Product Categories/Family for Sortase recombinant protein

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
Molecular weight of Molecular weight of approximately 20kDa

Similar Products

Product Notes

The Sortase (Catalog #AAA59633) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MQAKPQIPKD KSKVAGYIEI PDADIKEPVY PGPATREQLN RGVCFHDENE SLDDQNISIA GHTFIDRPNY QFTNLKAAKP GSMVYFKVGN ETRIYKMTSI RKVHPNAVEV LDEQEGKDKQ LTLVTCDDYN EETGVWESRK IFVATEVKGS HHHHHH. It is sometimes possible for the material contained within the vial of "Sortase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.