Serine protease inhibitor Kazal-type 3 Recombinant Protein | Spink3 recombinant protein
Recombinant Mouse Serine protease inhibitor Kazal-type 3
Gene Names
Spink1; p12; Spink3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine protease inhibitor Kazal-type 3; N/A; Recombinant Mouse Serine protease inhibitor Kazal-type 3; P12; Prostatic secretory glycoprotein; Spink3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-80. Full Length of Mature Protein
Sequence
AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Spink3 recombinant protein
Serine protease inhibitor which exhibits anti-trypsin activity. Inhibits the uptake of calcium by spermatozoa.
References
A secretory protease inhibitor requires androgens for its expression in male sex accessory tissues but is expressed constitutively in pancreas.Mills J.S., Needham M., Parker M.G.EMBO J. 6:3711-3717(1987) Purification and characterization of a trypsin inhibitor from mouse seminal vesicle secretion.Lai M.-L., Chen S.-W., Chen Y.-H.Arch. Biochem. Biophys. 290:265-271(1991) Developmental profile of a caltrin-like protease inhibitor, P12, in mouse seminal vesicle and characterization of its binding sites on sperm surface.Chen L.-Y., Lin Y.-H., Lai M.-L., Chen Y.-H.Biol. Reprod. 59:1498-1505(1998)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33.1 kDa
NCBI Official Full Name
serine protease inhibitor Kazal-type 1
NCBI Official Synonym Full Names
serine peptidase inhibitor, Kazal type 1
NCBI Official Symbol
Spink1
NCBI Official Synonym Symbols
p12; Spink3
NCBI Protein Information
serine protease inhibitor Kazal-type 1
UniProt Protein Name
Serine protease inhibitor Kazal-type 1
UniProt Gene Name
Spink1
UniProt Entry Name
ISK1_MOUSE
Similar Products
Product Notes
The Spink3 spink1 (Catalog #AAA114543) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-80. Full Length of Mature Protein. The amino acid sequence is listed below: AKVTGKEASC HDAVAGCPRI YDPVCGTDGI TYANECVLCF ENRKRIEPVL IRKGGPC. It is sometimes possible for the material contained within the vial of "Serine protease inhibitor Kazal-type 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
