Meiotic recombination protein SPO11 (SPO11) Recombinant Protein | SPO11 recombinant protein
Recombinant Human Meiotic recombination protein SPO11 (SPO11)
Gene Names
SPO11; CT35; TOPVIA; SPATA43
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Meiotic recombination protein SPO11 (SPO11); N/A; Recombinant Human Meiotic recombination protein SPO11 (SPO11); SPO11 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-396aa; Full Length
Sequence
MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASSSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIKFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SPO11 recombinant protein
Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5 end of DSBs and is essential for the formation of DSBs. This protein is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,364 Da
NCBI Official Full Name
meiotic recombination protein SPO11 isoform a
NCBI Official Synonym Full Names
SPO11, initiator of meiotic double stranded breaks
NCBI Official Symbol
SPO11
NCBI Official Synonym Symbols
CT35; TOPVIA; SPATA43
NCBI Protein Information
meiotic recombination protein SPO11
UniProt Protein Name
Meiotic recombination protein SPO11
UniProt Gene Name
SPO11
UniProt Synonym Gene Names
CT35
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The SPO11 spo11 (Catalog #AAA116891) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-396aa; Full Length. The amino acid sequence is listed below: MAFAPMGPEA SFFDVLDRHR ESLLAALRRG GREPPTGGSR LASSSEVLAS IENIIQDIIT SLARNEAPAF TIDNRSSWEN IKFEDSVGLQ MVSHCTTRKI KSDSPKSAQK FSLILKILSM IYKLVQSNTY ATKRDIYYTD SQLFGNQTVV DNIINDISCM LKVSRRSLHI LSTSKGLIAG NLRYIEEDGT KVNCTCGATA VAVPSNIQGI RNLVTDAKFV LIVEKDATFQ RLLDDNFCNK LSPCIMITGK GVPDLNTRLL VKKLWDTFHV PVFTLVDADP HGIEIMCIYK YGSMSMSFEA HHLTVPAIRW LGLLPSDLKR LNVPKDSLIP LTKRDQMKLD SILRRPYVTC QPFWRKEMEI MADSKMKAEI QALTFLSSDY LSRVYLPNKL KFGGWI. It is sometimes possible for the material contained within the vial of "Meiotic recombination protein SPO11 (SPO11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.