Squamous Cell Carcinoma Antigen 1 Recombinant Protein | SCCA1 recombinant protein
Recombinant Human Squamous Cell Carcinoma Antigen 1 (SCCA1)
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
Squamous Cell Carcinoma Antigen 1; N/A; Recombinant Human Squamous Cell Carcinoma Antigen 1 (SCCA1); SERPINB3; HsT1196; SCC; SCCA-1; SCCA-PD; T4-A; Serpin Peptidase Inhibitor, Clade B(ovalbumin), Member 3; Serpin B3.; SCCA1 recombinant protein
Host
E. coli
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH 8.0) added with 100 mM GSH and 15% glycerol.
Concentration
1 mg/mL (varies by lot)
Sequence Positions
1-390 AA
Sequence
MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Source
Human
Protein Residues
with N-terminal GST-tag.
Endotoxin Level
Please contact us for more information.
Usage
SCCA1 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Storage: Store it under sterile conditions at -20°C upon receiving.
Recommend to aliquot the protein into smaller quantities for optimal storage.
Avoid repeated freeze-thaw cycles.
Stability: The recombinant protein is stable for up to 6-12 months from date of receipt at -20°C to -80°C.
Recommend to aliquot the protein into smaller quantities for optimal storage.
Avoid repeated freeze-thaw cycles.
Stability: The recombinant protein is stable for up to 6-12 months from date of receipt at -20°C to -80°C.
Related Product Information for SCCA1 recombinant protein
Squamous cell carcinoma antigen (SCCA), a member of the serine protease inhibitor (serpin) family, is a subfraction of the tumor associated antigen TA-4, is a glycoprotein, with a molecular weight between 42 to 48 kDa. Total SCCA in the circulation comprises 2 nearly identical, approximately 45 kDa proteins, SCCA1 and SCCA2. Both proteins are members of the high-molecular weight serine proteinase inhibitor (serpin) family with SCCA1 paradoxically inhibiting lysosomal cysteine proteinases and SCCA2 inhibiting chymotrypsin-like serine proteinases. Although SCCA1 and SCCA2 are detected in the cytoplasm of normal squamous epithelial cells, neither serpin is detected normally in the serum.
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
Predicted: 71 kDa
Observed: 71 kDa
Observed: 71 kDa
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The SCCA1 (Catalog #AAA55764) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-390 AA. The amino acid sequence is listed below: MNSLSEANTK FMFDLFQQFR KSKENNIFYS PISITSALGM VLLGAKDNTA QQIKKVLHFD QVTENTTGKA ATYHVDRSGN VHHQFQKLLT EFNKSTDAYE LKIANKLFGE KTYLFLQEYL DAIKKFYQTS VESVDFANAP EESRKKINSW VESQTNEKIK NLIPEGNIGS NTTLVLVNAI YFKGQWEKKF NKEDTKEEKF WPNKNTYKSI QMMRQYTSFH FASLEDVQAK VLEIPYKGKD LSMIVLLPNE IDGLQKLEEK LTAEKLMEWT SLQNMRETRV DLHLPRFKVE ESYDLKDTLR TMGMVDIFNG DADLSGMTGS RGLVLSGVLH KAFVEVTEEG AEAAAATAVV GFGSSPTSTN EEFHCNHPFL FFIRQNKTNS ILFYGRFSSP. It is sometimes possible for the material contained within the vial of "Squamous Cell Carcinoma Antigen 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
