Sex-determining region Y protein Recombinant Protein | Sry recombinant protein
Recombinant Mouse Sex-determining region Y protein
Gene Names
Sry; Tdf; Tdy
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sex-determining region Y protein; N/A; Recombinant Mouse Sex-determining region Y protein; Testis-determining factor; Sry recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-144aa; Partial
Sequence
MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYSKNQQSFYWQPVDIPTGHLQ
Sequence Length
395
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Sry recombinant protein
Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons. Involved in different aspects of gene regulation including promoter activation or repression. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Promotes DNA bending. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'. 1 Publication
References
Inverted repeat structure of the Sry locus in mice.Gubbay J., Vivian N., Economou A., Jackson D., Goodfellow P.Proc. Natl. Acad. Sci. U.S.A. 89:7953-7957(1992) Rapid evolution of the sex determining locus in Old World mice and rats.Tucker P.K., Lundrigan B.L.Nature 364:715-717(1993) Polymorphism of a CAG trinucleotide repeat within Sry correlates with B6.YDom sex reversal.Coward P., Nagai K., Chen D., Thomas H.D., Nagamine C.M., Lau Y.-F.C.Nat. Genet. 6:245-250(1994) A gene mapping to the sex-determining region of the mouse Y chromosome is a member of a novel family of embryonically expressed genes.Gubbay J., Collignon J., Koopman P., Capel B., Economou A., Munsterberg A., Vivian N., Goodfellow P., Lovell-Badge R.Nature 346:245-250(1990) Definition of a consensus DNA binding site for SRY.Harley V.R., Lovell-Badge R., Goodfellow P.N.Nucleic Acids Res. 22:1500-1501(1994) Distinct DNA-binding properties of the high mobility group domain of murine and human SRY sex-determining factors.Giese K., Pagel J., Grosschedl R.Proc. Natl. Acad. Sci. U.S.A. 91:3368-3372(1994) Expression of Sry, the mouse sex determining gene.Hacker A., Capel B., Goodfellow P., Lovell-Badge R.Development 121:1603-1614(1995) Expression of a linear Sry transcript in the mouse genital ridge.Jeske Y.W., Bowles J., Greenfield A., Koopman P.Nat. Genet. 10:480-482(1995) Developmental profile of Sry transcripts in mouse brain.Mayer A., Mosler G., Just W., Pilgrim C., Reisert I.Neurogenetics 3:25-30(2000) Evidence that Sry is expressed in pre-Sertoli cells and Sertoli and granulosa cells have a common precursor.Albrecht K.H., Eicher E.M.Dev. Biol. 240:92-107(2001) The C-terminal nuclear localization signal of the sex-determining region Y (SRY) high mobility group domain mediates nuclear import through importin beta 1.Forwood J.K., Harley V., Jans D.A.J. Biol. Chem. 276:46575-46582(2001) Sry-directed sex reversal in transgenic mice is robust with respect to enhanced DNA bending comparison of human and murine HMG boxes.Phillips N.B., Nikolskaya T., Jancso-Radek A., Ittah V., Jiang F., Singh R., Haas E., Weiss M.A.Biochemistry 43:7066-7081(2004) Regulation of human SRY subcellular distribution by its acetylation/deacetylation.Thevenet L., Mejean C., Moniot B., Bonneaud N., Galeotti N., Aldrian-Herrada G., Poulat F., Berta P., Benkirane M., Boizet-Bonhoure B.EMBO J. 23:3336-3345(2004) Sry associates with the heterochromatin protein 1 complex by interacting with a KRAB domain protein.Oh H.J., Li Y., Lau Y.-F.C.Biol. Reprod. 72:407-415(2005) NHERF2/SIP-1 interacts with mouse SRY via a different mechanism than human SRY.Thevenet L., Albrecht K.H., Malki S., Berta P., Boizet-Bonhoure B., Poulat F.J. Biol. Chem. 280:38625-38630(2005) Direct regulation of adult brain function by the male-specific factor SRY.Dewing P., Chiang C.W., Sinchak K., Sim H., Fernagut P.-O., Kelly S., Chesselet M.-F., Micevych P.E., Albrecht K.H., Harley V.R., Vilain E.Curr. Biol. 16:415-420(2006) The poly(ADP-ribose) polymerase 1 interacts with Sry and modulates its biological functions.Li Y., Oh H.J., Lau Y.-F.C.Mol. Cell. Endocrinol. 257:35-46(2006) Sry and the hesitant beginnings of male development.Polanco J.C., Koopman P.Dev. Biol. 302:13-24(2007) KRAB a partner for SRY action on chromatin.Oh H.J., Lau Y.F.Mol. Cell. Endocrinol. 247:47-52(2006)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21.2 kDa
NCBI Official Full Name
sex-determining region Y protein
NCBI Official Synonym Full Names
sex determining region of Chr Y
NCBI Official Symbol
Sry
NCBI Official Synonym Symbols
Tdf; Tdy
NCBI Protein Information
sex-determining region Y protein
UniProt Protein Name
Sex-determining region Y protein
UniProt Gene Name
Sry
UniProt Synonym Gene Names
Tdf; Tdy
UniProt Entry Name
SRY_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Sry sry (Catalog #AAA113930) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-144aa; Partial. The amino acid sequence is listed below: MEGHVKRPMN AFMVWSRGER HKLAQQNPSM QNTEISKQLG CRWKSLTEAE KRPFFQEAQR LKILHREKYP NYKYQPHRRA KVSQRSGILQ PAVASTKLYN LLQWDRNPHA ITYRQDWSRA AHLYSKNQQS FYWQPVDIPT GHLQ. It is sometimes possible for the material contained within the vial of "Sex-determining region Y protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
