CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase Recombinant Protein | ST3GAL3 recombinant protein
Recombinant Human CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; N/A; Recombinant Human CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; Beta-galactoside alpha-2,3-sialyltransferase 3; Alpha 2,3-ST 3; Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase; N-acetyllactosaminide alpha-2,3-sialyltransferase; ST3Gal III; ST3GalIII; ST3N; Sialyltransferase 6; ST3GAL3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-375aa;Partial
Sequence
KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for ST3GAL3 recombinant protein
Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc.
Product Categories/Family for ST3GAL3 recombinant protein
References
Cloning and expression of human Gal beta 1,3(4) GlcNAc alpha 2,3-sialyltransferase.Kitagawa H., Paulson J.C.Biochem. Biophys. Res. Commun. 194:375-382(1993) Structural variations of the alpha 2,3-sialyltransferase III, ST3GalIII, transcripts in human peripheral white blood cells.Grahn A., Larson G.Structural variations of the alpha 2,3-sialyltransferase III, ST3GalIII, transcripts in human fetal brain.Grahn A., Larson G. The DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006) ST3GAL3 mutations impair the development of higher cognitive functions.Hu H., Eggers K., Chen W., Garshasbi M., Motazacker M.M., Wrogemann K., Kahrizi K., Tzschach A., Hosseini M., Bahman I., Hucho T., Muhlenhoff M., Gerardy-Schahn R., Najmabadi H., Ropers H.H., Kuss A.W.Am. J. Hum. Genet. 89:407-414(2011) West syndrome caused by ST3Gal-III deficiency.Edvardson S., Baumann A.M., Muehlenhoff M., Stephan O., Kuss A.W., Shaag A., He L., Zenvirt S., Tanzi R., Gerardy-Schahn R., Elpeleg O.Epilepsia 54:E24-E27(2013)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54.9 kDa
NCBI Official Full Name
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform k
UniProt Protein Name
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase
UniProt Gene Name
ST3GAL3
UniProt Synonym Gene Names
SIAT6; Alpha 2,3-ST 3; ST3GalIII
UniProt Entry Name
SIAT6_HUMAN
Similar Products
Product Notes
The ST3GAL3 st3gal3 (Catalog #AAA117739) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-375aa;Partial. The amino acid sequence is listed below: KLHLLQWEED SNSVVLSFDS AGQTLGSEYD RLGFLLNLDS KLPAELATKY ANFSEGACKP GYASALMTAI FPRFSKPAPM FLDDSFRKWA RIREFVPPFG IKGQDNLIKA ILSVTKEYRL TPALDSLRCR RCIIVGNGGV LANKSLGSRI DDYDIVVRLN SAPVKGFEKD VGSKTTLRIT YPEGAMQRPE QYERDSLFVL AGFKWQDFKW LKYIVYKERV SASDGFWKSV ATRVPKEPPE IRILNPYFIQ EAAFTLIGLP FNNGLMGRGN IPTLGSVAVT MALHGCDEVA VAGFGYDMST PNAPLHYYET VRMAAIKESW THNIQREKEF LRKLVKARVI TDLSSGI. It is sometimes possible for the material contained within the vial of "CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
