SDS-PAGE
Scytonema varium Scytovirin Recombinant Protein | SVN recombinant protein
Recombinant Scytonema varium Scytovirin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Scytonema varium Scytovirin; N/A; Recombinant Scytonema varium Scytovirin; SVN recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-95aa; Full Length
Sequence
GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for SVN recombinant protein
Has strong anti-HIV activity against T-tropic strains of HIV-1 and weaker activity against M-tropic strains of HIV-1. Inhibits HIV-1 fusion and infection of CD4 LTR beta-gal cells in vitro. Inhibits fusion of HIV infected C-SS cells with uninfected C-SS cells, and fusion of HIV-1 Env expressing HL2/3 cells with CD4 LTR beta-gal cells. Binds to HIV gp120, HIV gp160 and to a lesser extent HIV gp41. Binding to HIV gp120 is glycosylation dependent. Binds with high specificity to the tetrasaccharide Man-alpha-1,2-Man-alpha-1,6-Man-alpha-1,6-Man and also binds the higher-order oligosaccharides oligomannose 8 and oligomannose 9. Does not bind to monosaccharides, complex or hybrid N-linked oligosaccharides or chitin.
References
A potent novel anti-HIV protein from the cultured cyanobacterium Scytonema varium.Bokesch H.R., O'Keefe B.R., McKee T.C., Pannell L.K., Patterson G.M.L., Gardella R.S., Sowder R.C. II, Turpin J., Watson K., Buckheit R.W. Jr., Boyd M.R.Biochemistry 42:2578-2584(2003) A potent novel anti-HIV protein from the cultured cyanobacterium Scytonema varium.Bokesch H.R., O'Keefe B.R., McKee T.C., Pannell L.K., Patterson G.M.L., Gardella R.S., Sowder R.C. II, Turpin J., Watson K., Buckheit R.W. Jr., Boyd M.R.Biochemistry 42:2578-2584(2003) . Potent anti-HIV activity of scytovirin domain 1 peptide.Xiong C., O'Keefe B.R., Byrd R.A., McMahon J.B.Peptides 27:1668-1675(2006) Overexpression and purification of scytovirin, a potent, novel anti-HIV protein from the cultured cyanobacterium Scytonema varium.Xiong C., O'Keefe B.R., Botos I., Wlodawer A., McMahon J.B.Protein Expr. Purif. 46:233-239(2006) Carbohydrate microarrays as tools in HIV glycobiology.Ratner D.M., Seeberger P.H.Curr. Pharm. Des. 13:173-183(2007) The novel fold of scytovirin reveals a new twist for antiviral entry inhibitors.McFeeters R.L., Xiong C., O'Keefe B.R., Bokesch H.R., McMahon J.B., Ratner D.M., Castelli R., Seeberger P.H., Byrd R.A.J. Mol. Biol. 369:451-461(2007) Atomic-resolution crystal structure of the antiviral lectin scytovirin.Moulaei T., Botos I., Ziolkowska N.E., Bokesch H.R., Krumpe L.R., McKee T.C., O'Keefe B.R., Dauter Z., Wlodawer A.Protein Sci. 16:2756-2760(2007)
NCBI and Uniprot Product Information
Similar Products
Product Notes
The Scytonema varium Scytovirin svn (Catalog #AAA115543) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-95aa; Full Length. The amino acid sequence is listed below: GSGPTYCWNE ANNPGGPNRC SNNKQCDGAR TCSSSGFCQG TSRKPDPGPK GPTYCWDEAK NPGGPNRCSN SKQCDGARTC SSSGFCQGTA GHAAA. It is sometimes possible for the material contained within the vial of "Scytonema varium Scytovirin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.