Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114778_SDS_PAGE15.jpg SDS-PAGE

strain K12 Methyl-accepting chemotaxis protein II Recombinant Protein | tar recombinant protein

Recombinant strain K12 Methyl-accepting chemotaxis protein II

Average rating 0.0
No ratings yet
Gene Names
tar; cheM; ECK1887; JW1875
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
strain K12 Methyl-accepting chemotaxis protein II; N/A; Recombinant strain K12 Methyl-accepting chemotaxis protein II; Aspartate chemoreceptor protein; tar recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
212-553aa; Cytoplasmic Domain
Sequence
IRRMLLTPLAKIIAHIREIAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLAASPLTNKPQTPSRPASEQPPAQPRLRIAEQDPNWETF
Sequence Length
553
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114778_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for tar recombinant protein
Receptor for the attractant L-aspartate and related amino and dicarboxylic acids. Tar also mediates taxis to the attractant maltose via an interaction with the periplasmic maltose binding protein. Tar mediates taxis away from the repellents cobalt and nickel. Chotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment, transduce a signal from the outside to the inside of the cell, and facilitate sensory adaptation through the variation of the level of methylation. Attractants increase the level of methylation while repellents decrease the level of methylation, the methyl groups are added by the methyltransferase CheR and roved by the methylesterase CheB.
References
Sensory transducers of E. coli are composed of discrete structural and functional domains.Krikos A., Mutoh N., Boyd A., Simon M.I.Cell 33:615-622(1983) A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.Itoh T., Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Kasai H., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S., Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:379-392(1996) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997) Global topology analysis of the Escherichia coli inner membrane proteome.Daley D.O., Rapp M., Granseth E., Melen K., Drew D., von Heijne G.Science 308:1321-1323(2005) Isolation and identification of new inner membrane-associated proteins that localize to cell poles in Escherichia coli.Li G., Young K.D.Mol. Microbiol. 84:276-295(2012) The three-dimensional structure of the aspartate receptor from Escherichia coli.Bowie J.U., Pakula A.A., Simon M.I.Acta Crystallogr. D 51:145-154(1995) Apo structure of the ligand-binding domain of aspartate receptor from Escherichia coli and its comparison with ligand-bound or pseudoligand-bound structures.Chi Y.-I., Yokota H., Kim S.-H.FEBS Lett. 414:327-332(1997)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
methyl-accepting chemotaxis protein II
NCBI Official Symbol
tar
NCBI Official Synonym Symbols
cheM; ECK1887; JW1875
NCBI Protein Information
methyl-accepting chemotaxis protein II
UniProt Protein Name
Methyl-accepting chemotaxis protein II
UniProt Gene Name
tar
UniProt Synonym Gene Names
cheM; MCP-II
UniProt Entry Name
MCP2_ECOLI

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The tar tar (Catalog #AAA114778) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 212-553aa; Cytoplasmic Domain. The amino acid sequence is listed below: IRRMLLTPLA KIIAHIREIA GGNLANTLTI DGRSEMGDLA QSVSHMQRSL TDTVTHVREG SDAIYAGTRE IAAGNTDLSS RTEQQASALE ETAASMEQLT ATVKQNADNA RQASQLAQSA SDTAQHGGKV VDGVVKTMHE IADSSKKIAD IISVIDGIAF QTNILALNAA VEAARAGEQG RGFAVVAGEV RNLASRSAQA AKEIKALIED SVSRVDTGSV LVESAGETMN NIVNAVTRVT DIMGEIASAS DEQSRGIDQV ALAVSEMDRV TQQNASLVQE SAAAAAALEE QASRLTQAVS AFRLAASPLT NKPQTPSRPA SEQPPAQPRL RIAEQDPNWE TF. It is sometimes possible for the material contained within the vial of "strain K12 Methyl-accepting chemotaxis protein II, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.