strain K12 Methyl-accepting chemotaxis protein II Recombinant Protein | tar recombinant protein

Recombinant strain K12 Methyl-accepting chemotaxis protein II

Cat. Num. AAA114778

• Gene Names: tar; cheM; ECK1887; JW1875
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: strain K12 Methyl-accepting chemotaxis protein II; N/A; Recombinant strain K12 Methyl-accepting chemotaxis protein II; Aspartate chemoreceptor protein; tar recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 212-553aa; Cytoplasmic Domain
• Sequence: IRRMLLTPLAKIIAHIREIAGGNLANTLTIDGRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASASDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLAASPLTNKPQTPSRPASEQPPAQPRLRIAEQDPNWETF
• Sequence Length: 553

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for tar recombinant protein

Receptor for the attractant L-aspartate and related amino and dicarboxylic acids. Tar also mediates taxis to the attractant maltose via an interaction with the periplasmic maltose binding protein. Tar mediates taxis away from the repellents cobalt and nickel. Chotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment, transduce a signal from the outside to the inside of the cell, and facilitate sensory adaptation through the variation of the level of methylation. Attractants increase the level of methylation while repellents decrease the level of methylation, the methyl groups are added by the methyltransferase CheR and roved by the methylesterase CheB.

References

Sensory transducers of E. coli are composed of discrete structural and functional domains.Krikos A., Mutoh N., Boyd A., Simon M.I.Cell 33:615-622(1983) A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.Itoh T., Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Kasai H., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S., Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:379-392(1996) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Escherichia coli proteome analysis using the gene-protein database.VanBogelen R.A., Abshire K.Z., Moldover B., Olson E.R., Neidhardt F.C.Electrophoresis 18:1243-1251(1997) Global topology analysis of the Escherichia coli inner membrane proteome.Daley D.O., Rapp M., Granseth E., Melen K., Drew D., von Heijne G.Science 308:1321-1323(2005) Isolation and identification of new inner membrane-associated proteins that localize to cell poles in Escherichia coli.Li G., Young K.D.Mol. Microbiol. 84:276-295(2012) The three-dimensional structure of the aspartate receptor from Escherichia coli.Bowie J.U., Pakula A.A., Simon M.I.Acta Crystallogr. D 51:145-154(1995) Apo structure of the ligand-binding domain of aspartate receptor from Escherichia coli and its comparison with ligand-bound or pseudoligand-bound structures.Chi Y.-I., Yokota H., Kim S.-H.FEBS Lett. 414:327-332(1997)

NCBI and Uniprot Product Information

• NCBI GI #: 16129838
• NCBI GeneID: 946399
• NCBI Accession #: NP_416400.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P07017; P76301
• Molecular Weight: 52 kDa
• NCBI Official Full Name: methyl-accepting chemotaxis protein II
• NCBI Official Symbol: tar
• NCBI Official Synonym Symbols: cheM; ECK1887; JW1875
• NCBI Protein Information: methyl-accepting chemotaxis protein II
• UniProt Protein Name: Methyl-accepting chemotaxis protein II
• UniProt Gene Name: tar
• UniProt Synonym Gene Names: cheM; MCP-II
• UniProt Entry Name: MCP2_ECOLI