Telomerase reverse transcriptase (TERT) Recombinant Protein | TERT recombinant protein
Recombinant Dog Telomerase reverse transcriptase (TERT), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Telomerase reverse transcriptase (TERT); N/A; Recombinant Dog Telomerase reverse transcriptase (TERT), partial; TERT recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-308; Fragment at the N-terminal include RNA-interacting domain 1 domain
Sequence
MPRAPRCRAVRALLRGRYREVLPLATFLRRLGPPGRLLVRRGDPAAFRALVAQCLVCVPWGARPPPAAPCFRQVSCLKELVARVVQRLCERGARNVLAFGFALLDGARGGPPVAFTTSVRSYLPNTVTETLRGSGAWGLLLRRVGDDVLTHLLARCALYLLVAPSCAYQVCGPPLYDLCAPASLPLPAPGLPGLPGLPGLGAGAGASADLRPTRQAQNSGARRRRGSPGSGVPLAKRPRRSVASEPERGAHRSFPRAQQPPVSEAPAVTPAVAASPAASWEGGPPGTRPTTPAWHPYPGPQGVPHDPA
Sequence Length
308
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TERT recombinant protein
Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced variants encoding different isoforms of telomerase reverse transcriptase have been identified; the full-length sequence of some variants has not been determined. Alternative splicing at this locus is thought to be one mechanism of regulation of telomerase activity.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
124,825 Da
NCBI Official Full Name
telomerase reverse transcriptase
NCBI Official Synonym Full Names
telomerase reverse transcriptase
NCBI Official Symbol
TERT
NCBI Protein Information
telomerase reverse transcriptase
UniProt Protein Name
Telomerase reverse transcriptase
UniProt Gene Name
TERT
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The TERT tert (Catalog #AAA117769) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-308; Fragment at the N-terminal include RNA-interacting domain 1 domain. The amino acid sequence is listed below: MPRAPRCRAV RALLRGRYRE VLPLATFLRR LGPPGRLLVR RGDPAAFRAL VAQCLVCVPW GARPPPAAPC FRQVSCLKEL VARVVQRLCE RGARNVLAFG FALLDGARGG PPVAFTTSVR SYLPNTVTET LRGSGAWGLL LRRVGDDVLT HLLARCALYL LVAPSCAYQV CGPPLYDLCA PASLPLPAPG LPGLPGLPGL GAGAGASADL RPTRQAQNSG ARRRRGSPGS GVPLAKRPRR SVASEPERGA HRSFPRAQQP PVSEAPAVTP AVAASPAASW EGGPPGTRPT TPAWHPYPGP QGVPHDPA. It is sometimes possible for the material contained within the vial of "Telomerase reverse transcriptase (TERT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.