26 kDa secreted antigen Recombinant Protein | TES26 recombinant protein
Recombinant Toxocara canis 26 kDa secreted antigen
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
26 kDa secreted antigen; N/A; Recombinant Toxocara canis 26 kDa secreted antigen; Toxocara excretory-secretory antigen 26; TES-26; TES26 recombinant protein
Host
Yeast
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer 50% glycerol
Sequence Positions
Full Length, 22-262aa
Sequence
QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGL
CAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSA
ANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPG
FGTTAFATQFNLGSPYAGNFYRSQA
Immunogen Description
Expression Region:22-262aaSequence Info:Full Length
Calculated MW
27.9kDa
Tag Info
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Related Product Information for TES26 recombinant protein
Recombinant protein.
Binds phosphalethanolamine.
Binds phosphalethanolamine.
NCBI and Uniprot Product Information
Similar Products
Product Notes
The TES26 tes-26 (Catalog #AAA309794) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 22-262aa. The amino acid sequence is listed below: QCMDSASDCA ANAGSCFTRP VSQVLQNRCQ RTCNTCDCRD EANNCAASIN LCQNPTFEPL VRDRCQKTCG L CAGCGFIS SGIVPLVVTS APSRRVSVTF ANNVQVNCGN TLTTAQVANQ PTVTWEAQPN DRYTLIMVDP DFPSA ANGQ QGQRLHWWVI NIPGNNIAGG TTLAAFQPST PAANTGVHRY VFLVYRQPAA INSPLLNNLV VQDSERPG F GTTAFATQFN LGSPYAGNFY RSQA. It is sometimes possible for the material contained within the vial of "26 kDa secreted antigen, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.